KEGG   Nitrosococcus watsonii: Nwat_0287Help
Entry
Nwat_0287         CDS       T01266                                 

Definition
(GenBank) magnesium transporter
  KO
K06213  magnesium transporter
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwa02000]
    Nwat_0287
Transporters [BR:nwa02000]
 Other Transporters
  Pores ion channels [TC:1]
   Nwat_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtE_N MgtE CBS Dcc1
Motif
Other DBs
NCBI-ProteinID: ADJ27257
UniProt: D8K9G8
Position
complement(300430..301788)
Genome map
AA seq 452 aa AA seqDB search
MLQSTSPGRGNEHLNALAAALESGRMVRLRRLLSSLHPAEVAHLLESLPPSTRHLAWRFV
STDHRGEVLSYVGDEVRSDLMDNIAVADLASLTEDLDPDDLASILRDLPEAAIEQVLHTM
DAQNRHRLETVLSYPEDTAGGLMNTDTITVRADVTLDVVHRYLRLLGTLPDATDSLFVVD
REDKYQGILQLTTLLTRKRELTVTEVMSHGVESIPALLPAAEVAQRFEKQDLISAPIVDE
KGKLLGRITIDDVVDVIRDEADRSLMNMAGFTEDEDTFAPALISLRRRSLWLGINLMTAF
LAAWVIGLFEATIQKQVALAVLMPIVASMGGIAGSQTLTLIIRATALGYLNQSNIRWLLG
KELALGALNGLLWAAVIGVVSAIWFEGIGLGILIGSAIIINLIFAALSGVVVPLFLRRIG
ADPALAGGVLLTTITDVVGFMAFLGFATLFLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaatccacctccccaggaaggggaaacgagcacttaaatgccctggcagcggca
cttgaaagcggccgcatggtgcgcctacggcgcctgctcagcagcctgcatcctgctgaa
gttgctcatttactagagtcactgccgccctcaacccggcatttagcctggcggttcgtg
agcaccgaccatcggggtgaagttttaagctatgttggcgatgaggtgcgttccgatctc
atggacaatattgcggtagcagatctggcttcgctgacagaggacctggaccccgacgat
ttggctagcattcttcgggatctgcccgaagcagcaatcgaacaggttttgcatactatg
gatgctcagaatcggcaccgcttggaaaccgtactctcctacccggaagataccgcaggc
ggcctcatgaataccgataccatcaccgttcgcgctgatgtcaccctagatgtcgtccat
cgctacctgcgtctcctaggaacgctacccgacgccacagacagcttgttcgtcgtggac
cgggaagataaataccaaggaatattacagcttactacgctgctaacgcgaaaacgggaa
ctgacagtaacggaagtaatgtcccatggcgtagaaagcattcctgccttgctgcctgct
gctgaggtagcccaacgctttgagaaacaagacttgatttcggcgcctattgtggatgag
aagggaaaattactgggccgaatcactattgatgacgtggttgacgtgattcgagacgag
gcggatcgctccttgatgaatatggcgggatttactgaggatgaggatacatttgccccg
gcgctgatcagcctgcggcgacgttccctctggttggggatcaatctgatgaccgccttc
ctcgcagcctgggttattggactgtttgaggcaactatccagaagcaagtggccctggcg
gtactcatgcccatcgtggccagcatgggaggcattgctggcagtcaaacgcttaccttg
atcatccgcgctactgcccttggctatcttaatcaaagcaatatccgctggcttctaggc
aaagagctagccttgggagcccttaatggtctcctgtgggcagcggtcataggcgtagtc
tctgctatctggtttgaaggaattggattaggtattttgattgggtccgccatcattatc
aatctaattttcgctgccctttcaggggttgttgttccgctttttttacggcggataggg
gctgacccggccctggctggaggcgtcctccttaccaccatcaccgatgtagtgggcttc
atggcctttctagggtttgcaacgctttttttagtttga

DBGET integrated database retrieval system