KEGG   Nitrosococcus watsonii: Nwat_0290Help
Entry
Nwat_0290         CDS       T01266                                 

Definition
(GenBank) PTS system fructose subfamily IIA component
  KO
K02821  PTS system, ascorbate-specific IIA component [EC:2.7.1.194]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00053  Ascorbate and aldarate metabolism
nwa01100  Metabolic pathways
nwa01120  Microbial metabolism in diverse environments
nwa02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Nwat_0290
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Nwat_0290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwa02000]
    Nwat_0290
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     Nwat_0290
Transporters [BR:nwa02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    Nwat_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: ADJ27260
UniProt: D8K9H1
Position
complement(304014..304430)
Genome map
AA seq 138 aa AA seqDB search
MTVGVLIITHGNIGSSLLDTANDMLGSCPLQLKILRVTRASHPDALQRQAKEMINCLNMG
QGVLVLTDMYGSTPSNIACYVANEQQVQVVTGLNLPMLIRVLNYPRLSLTKLTEKAVSGG
REGVCACPTTMRTQDDTK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttggcgtgctgatcatcactcacggcaatattggctcatccttattagatacg
gccaatgacatgctgggaagctgtcccctccagctcaaaatactccgagttacccgtgct
tctcaccccgatgccttacagcggcaagcaaaagagatgataaactgcctgaacatgggc
caaggagttttggtgctcaccgatatgtacggttccacccccagcaatatcgcctgctac
gtggcgaatgaacagcaggtgcaggtcgttacgggtctgaacttaccgatgctaatacgg
gtgctaaattaccctcgtttgagcctcactaaactgacagaaaaggcagtaagcggtggg
cgtgaaggagtttgcgcctgccccaccacaatgaggacacaggatgacacaaaatga

DBGET integrated database retrieval system