KEGG   Nitrosococcus watsonii: Nwat_0292Help
Entry
Nwat_0292         CDS       T01266                                 

Definition
(GenBank) HPr kinase
  KO
K06023  HPr kinase/phosphorylase [EC:2.7.11.- 2.7.4.-]
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Nwat_0292
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.-  
     Nwat_0292
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     Nwat_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpr_kinase_C MMR_HSR1 AAA_16 AAA_29
Motif
Other DBs
NCBI-ProteinID: ADJ27262
UniProt: D8K9H3
Position
complement(305332..305928)
Genome map
AA seq 198 aa AA seqDB search
MGAELHSLECCYQVRLQGVSNPNENKMTSHGVLLIIFDCGVLLTGENSVGKSSLALELIR
RGHRLIADDAPLFQRTSAARLVGSCPHLLQDFLAVPGLGAINIRAIYGEQAIAVQHLLDL
VIHLIPSKPIEPLTRNLGQWERLKVKVPEITLPLMGTMQPATVIETAVQDHQLRIKGYDA
LLELQQRQQELLTPLSSR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagaactccactccctcgaatgttgctaccaagtgagattgcagggcgtgagc
aaccctaatgaaaataagatgacaagccacggcgtactgctcataatatttgactgtggc
gttctattaacgggagaaaacagcgttggtaaaagcagcctagctctagaattaatcagg
cgggggcatcgtttaatagcagacgatgcccctctctttcaacgcacgtcagcggcccga
ttagtgggtagctgtccccatctattgcaggattttctagctgtacctggtttgggggct
atcaatattcgtgctatctacggcgagcaagctattgccgtgcagcaccttcttgatctc
gtcatccaccttatccctagcaaacccatcgaacccctcacccgcaacctaggccagtgg
gagcggttaaaggtgaaagtacctgagatcaccctgcctctaatgggtactatgcagcca
gccacagtgatagaaacggcggtccaagaccatcaactgcggattaaaggttacgatgca
ttacttgagctgcagcagcggcaacaagagctactcacccccctctcatccaggtaa

DBGET integrated database retrieval system