KEGG   Nitrosococcus watsonii: Nwat_0299Help
Entry
Nwat_0299         CDS       T01266                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00540  Lipopolysaccharide biosynthesis
nwa01100  Metabolic pathways
Module
nwa_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Nwat_0299
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:nwa01005]
    Nwat_0299
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     Nwat_0299
Lipopolysaccharide biosynthesis proteins [BR:nwa01005]
 Unusual sugar
  Nwat_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 HAD_2 Hydrolase S6PP HAD Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ADJ27269
UniProt: D8K9I0
Position
complement(310356..310877)
Genome map
AA seq 173 aa AA seqDB search
MREVFAKASAIKLALFDVDGVLTDGGLYLDDNGQEYKVFHSRDGHGMKMLQHTGVKIGII
TGRTSRVVEYRMENLGITLVYQGQKIKLPAYEHLLEQLNLQPHETAYVGDDVVDLAIMRR
VGLAIAVQDAHPLVKQHAHWITPHLGGKGAARDVCELIMEAQGTLKAQLEKYY
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtatttgccaaagcctcggctataaaacttgctcttttcgatgtggatggc
gtactcaccgatggcggcctttatcttgacgataatggtcaggagtacaaagtttttcat
tctcgtgatggccatggcatgaaaatgctacaacatacaggcgttaaaattggaatcatt
acgggccgaacttcccgtgtagtcgaataccgcatggaaaaccttggaattactttggtg
taccaaggacaaaagattaagctccccgcctacgaacatctgcttgaacagcttaacctt
caaccccatgagactgcctatgtgggcgatgatgtcgtagatttggctattatgcggcga
gtggggcttgccatcgcggtccaagatgctcatccgctcgtcaagcaacacgctcactgg
attactccccacctcggtggcaaaggtgctgcgcgtgatgtctgcgagcttattatggag
gctcaaggaacgcttaaagcccagctggagaaatattattaa

DBGET integrated database retrieval system