KEGG   Nitrosococcus watsonii: Nwat_0301Help
Entry
Nwat_0301         CDS       T01266                                 

Definition
(GenBank) VacJ family lipoprotein
  KO
K04754  phospholipid-binding lipoprotein MlaA
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Nwat_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaA
Motif
Other DBs
NCBI-ProteinID: ADJ27271
UniProt: D8K9I2
Position
complement(312003..312830)
Genome map
AA seq 275 aa AA seqDB search
MNYTSAMVLWAKLTLLGILLSLSAGCATNATYDASHDPFEGFNRAIYKFNDAADRYVMKP
IAKGYDKVVPTPVDKGITNVFSNLNDLIVGLNGILQGKFQQGLTDFARFLANSTVGIGGL
FDVATSGGMVKHDEDFGQTLGVWGFNTGPYLVLPLLGASNIRDGVGLGVDALTWPVSYMG
NFGTRLGLAGIRTVDLRADLLEATDILKEAALDPYVYTREAFLQRRKFLVYDGKIPKEEI
PEEEFEFDDEFGEEEEIPEEPAGPSSPLPPYFPDR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaactatacatctgcaatggtactatgggccaagctcacgctactaggaatactcctc
agcttatcagctggctgcgcaactaacgctacctatgatgcttcccatgacccttttgaa
ggctttaaccgcgccatttacaaattcaatgatgctgccgatcgctatgttatgaaaccc
attgcgaagggttatgataaagtcgtacccacccctgttgacaaaggcattactaacgtt
ttcagcaatcttaatgacttgatcgttggcttaaacggcatcttgcaaggtaaattccag
caagggttaacagattttgcccgcttcctagccaatagcactgtgggtattggaggactg
tttgatgtagccacctcgggcgggatggttaaacacgacgaagattttgggcaaacactg
ggagtctgggggttcaataccggtccttatctggttttacccctcctcggagccagtaat
attcgagatggagtaggactaggcgttgatgcgctaacctggcctgttagctatatggga
aattttgggacaaggttagggctagcagggatacgaacggtagatctccgggcggattta
cttgaagcaaccgatattctaaaggaagccgctttagatccttatgtctatacccgggaa
gcctttctgcagcgccgtaaattcctagtatatgatggcaaaatacctaaggaagaaata
cccgaagaggaattcgaattcgacgatgaattcggtgaggaagaagaaatacctgaggaa
cctgcagggccttcttccccgctgcctccttattttccagaccgctaa

DBGET integrated database retrieval system