KEGG   Nitrosococcus watsonii: Nwat_0306Help
Entry
Nwat_0306         CDS       T01266                                 

Definition
(GenBank) toluene tolerance family protein
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa02010  ABC transporters
Module
nwa_M00210  Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Nwat_0306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwa02000]
    Nwat_0306
Transporters [BR:nwa02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter [MD:M00210]
    Nwat_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaC DUF3828 DUF3802
Motif
Other DBs
NCBI-ProteinID: ADJ27276
UniProt: D8K9I7
Position
315954..316613
Genome map
AA seq 219 aa AA seqDB search
MWRNVMDKYRRRDVGLAAFLILTIFGFNSSFIQADPLPTASAQQLVEKTSERMLQTLREK
REELEAHPEQIYDLVKEILVPHFDFQRISRLVLGKYWRQASVEQQQRFVDEFQTLLVRTY
STALLKYSDEKINYLPLRGPKEAEKIPVRMEIEQARGGSPISMEVDLYEKEKSWKVYNIR
IGGVSLVTNHRTNFANEIRHGGLDQLIDKLKEKNQKTGG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtggagaaacgtgatggataagtatcgtcggcgggatgtgggtttagctgcatttttg
atattaacgatttttggctttaactcctctttcatccaggctgatccgctacctaccgcc
tcagcccagcaattagtggagaaaacctctgaacgcatgctccagaccttgcgggaaaaa
agggaagagctggaagctcatccggagcagatctacgatttggtcaaagaaattcttgta
cctcattttgattttcaacgtatttcccggttggtgcttggaaagtactggcggcaagcc
tcagtggagcagcagcaacgttttgtggacgagtttcaaaccttactggttcggacctat
tctacagccttgctgaaatatagtgacgagaagattaattatttgccattgagagggccg
aaagaggctgaaaagattcctgttcgcatggagattgaacaggccagggggggatcgccc
atttctatggaagtggatttgtatgaaaaagaaaaaagctggaaggtctataacataaga
attggtggcgtaagcttggtaactaaccatcggactaattttgctaatgagatacgtcat
gggggacttgatcagctcattgataagttaaaggaaaaaaatcaaaaaaccggcggctaa

DBGET integrated database retrieval system