KEGG   Nitrosococcus watsonii: Nwat_0318Help
Entry
Nwat_0318         CDS       T01266                                 

Definition
(GenBank) extracellular solute-binding protein family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa02024  Quorum sensing
Module
nwa_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Nwat_0318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwa02000]
    Nwat_0318
Transporters [BR:nwa02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Nwat_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ADJ27288
UniProt: D8K9J9
Position
complement(329787..331646)
Genome map
AA seq 619 aa AA seqDB search
MARRFTVKDFFLLLFLSLLAVLILLAMYMVDRQWLKLSEIEQTLTEQARDLRGLRDLLHS
PGRNGLTLAPAEKQDAETIPLAFQRAYAATQQPDYHPGDWFVQAFGAGLKTLTPLVSTDA
YAADVQGYVLESLLTRHPETLEWQGLLARDWEISEDGLTFRFRLRKGLTFSDGQPLTAED
VAFSFSFIMNPAIAAPRERAYYEKIERVAALDPYQVEFKFKEPYFNSLALAGGLAILPQH
FYEPYLEQPESFNQSKGLLLGSGPYRLPDPKGWTPDQGLVELERNPRYWGPVQPPFDKLL
WKVIVNDSARLTTFRNGDIDLYSARPLEYQKLLEDQALAARTQHFEYRSPAAGYSYIAWN
QERNGKPTRFADQRVRQAMTFLTDRASMIEQIMLGHGEPAVSPFNPDSPQHDPALAPRPF
DLTKAKSLLEQAGYTDRDGDGVLEDASGQPFRFELVFFQDADDTRRLVLFLKDLYARAGI
LLEPKPTEWSVMLDRINKKNFDAIMLGWTSGVEIDIYQMFHSSQTLAGGDNFITYQNPEL
DQLIEKARATVNESERMPLWRACERILYEDQPYTFLMRRKSLVFVDQRVRNLEVTPLGLN
LGMTPVEVYVPGAEQKYAR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacgatttacggtcaaagattttttcctgcttctattcctgagcctgttagct
gtgctcattctgctcgccatgtacatggttgatcggcaatggcttaagctcagcgaaata
gagcagactctgaccgaacaggctcgggatttgcgcgggctgcgcgatctgctacatagc
ccaggccgcaacgggcttaccttggcgcccgccgagaagcaagacgcagaaactattccc
ctggcattccagcgcgcctacgccgctacccagcagcctgattaccatcctggcgactgg
ttcgtgcaagcttttggcgcggggctgaagaccttgacgcccctggtctccaccgatgcc
tatgccgctgacgttcagggctacgtgttggaatccctgctgacgcgtcacccagagact
ctggaatggcaaggtttgctagcccgcgattgggagatcagcgaagatgggctgactttc
cgtttccgcctgcggaaagggctcacattctccgatggccagcctcttaccgccgaggac
gtggctttctctttctcttttatcatgaatccggccattgccgcgccccgggaacgggct
tattatgaaaagattgagcgagtcgccgcccttgatccctaccaggtggagttcaaattt
aaggagccttactttaatagcctggctctggccggcggcctagccatcttgccccagcat
ttttacgaaccttatttggaacaaccggaaagctttaaccagtccaagggcctattgctg
ggctcgggtccttaccgcctcccagatcctaaaggctggactccggatcagggtctggtg
gagttggaacgtaacccccgttactggggaccggtgcagcctcctttcgacaagctacta
tggaaggttatcgttaatgacagcgcccgcctgactaccttccgcaatggggatattgat
ctctacagcgcccgtccgctagagtatcaaaaactgctggaagatcaggcgttggcggcg
cgcacccagcattttgagtatcggagccccgccgcgggctatagctatatcgcctggaac
caggagcgaaacggcaagcctacccgctttgccgatcagcgggtccgccaagccatgacc
tttcttactgaccgcgccagcatgatcgagcagatcatgctgggtcatggggaaccggcg
gtcagtccgttcaatcccgacagcccccagcatgatcccgctctcgctccccggcccttc
gatctaaccaaagccaagtctctattggagcaagcgggctacactgaccgggacggagac
ggggttctggaagatgccagcggccaacctttccgctttgagttggtgtttttccaggat
gccgatgatactcgccgcttggtactgtttctcaaggatctgtacgcccgggccgggatt
ttgcttgagcccaagcccaccgaatggtcggtcatgctggatcggatcaacaaaaagaac
ttcgacgccattatgctgggctggacgagcggagtcgaaatcgatatctaccaaatgttc
cacagcagccaaaccctagctggcggcgataattttattacttaccaaaatccagagctg
gaccagcttatcgagaaagcgcgggcaaccgtgaatgaaagcgagcgcatgcccctatgg
cgggcctgcgagcgtattttatatgaagaccaaccctatacttttctaatgcggcgtaaa
tcattggtatttgtggaccagcgggtgcgcaatctggaagtcacccccttgggcctgaac
ctgggcatgactccggtggaggtgtacgttccgggggccgagcaaaagtacgctcgctag

DBGET integrated database retrieval system