KEGG   Nitrosococcus watsonii: Nwat_0323Help
Entry
Nwat_0323         CDS       T01266                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00780  Biotin metabolism
nwa01100  Metabolic pathways
Module
nwa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Nwat_0323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nwa01007]
    Nwat_0323
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Nwat_0323
Amino acid related enzymes [BR:nwa01007]
 Aminotransferase (transaminase)
  Class II
   Nwat_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADJ27293
UniProt: D8K9K4
Position
335882..336979
Genome map
AA seq 365 aa AA seqDB search
MLDFTSVLYLGLRHSSGVLRPWTQLTSGKPAALITPAAQHRVAGALAELQGCEEATIGPS
TLHLFWDLFGILAKQGMAIYLDGGTYPIARWGVERAAARGIPVRRFPHRNPEALRRRLKQ
DSSRGLRPLVVADGFCPGCGKPIPLHAYLESARDWGGYLLLDDTQALGILGYSPSFRAPY
GREGGGSLPWHHAAGSDVLLVSSLAKGFGVPMAVLAGSHALIRWFKDKSETRTHCSPPSI
AIIHAAEHALKVNKSYGDGLRLRLARLVHYFRSRLAQIGWPTVGGLFPVQTLMPKPTLDA
RKLHEQLLRQGIQTVLHRGRKELGACLSFLITARHSRGDIDRAANAVARFAGKRDPQEIS
HEYCL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacttcacctctgtcctctatctgggactgcgtcattccagcggggtgctgcgc
ccgtggacgcagcttacttccggcaagccggcggccctgattacgccagcagcccagcac
cgcgtagctggggcgctggctgaattgcagggctgcgaggaggctactatcggcccttcc
accttgcatctgttctgggatctctttggcattctggcgaagcagggcatggcgatctac
ctggatggaggcacctatcccattgcccgctggggggtagaacgggcggcggcgcgaggt
attccggtgcggcgttttcctcaccgtaacccggaggctttgcggcggcgcttgaagcag
gatagctcacgcggtcttaggccccttgtggtcgcggatggcttttgccccggttgcggc
aagccaatcccccttcacgcctacttagaaagcgcacgggactggggcggctatttgctc
ctcgatgatacccaggcactaggcattcttggctattcgcccagctttagagcaccctac
gggcgggaaggaggcggatcgcttccttggcaccatgccgctgggtccgacgtgctcctg
gtcagctccctagccaagggttttggcgtgccaatggcggtgctggcaggcagtcatgcc
ttgatacgatggtttaaggataagagcgagacccgtacccactgtagcccgccttcaatc
gccatcatccatgcggccgagcatgctttgaaggtaaacaaaagctatggggatgggctg
cgcctacgtttggcgcggctcgttcactatttccgcagccgcctggcgcagatcggttgg
cccacggtaggcggattgtttcccgtccaaacccttatgcctaaacctacccttgatgcc
aggaaattacacgagcaacttctccggcaaggaatccaaacagtccttcaccgcggtcgc
aaggagcttggtgcatgtcttagctttctgattaccgcccgccacagccggggtgatatc
gaccgtgcggcaaatgccgttgcgcggtttgcggggaaaagagacccacaggagattagc
catgaatactgcctttga

DBGET integrated database retrieval system