KEGG   Nitrosococcus watsonii: Nwat_0331Help
Entry
Nwat_0331         CDS       T01266                                 

Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase [EC:2.5.1.145]
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Nwat_0331
Enzymes [BR:nwa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.145  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase
     Nwat_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGT DUF4131
Motif
Other DBs
NCBI-ProteinID: ADJ27301
UniProt: D8K9L2
Position
346286..347092
Genome map
AA seq 268 aa AA seqDB search
MSYPNIDPVAFSLGPLKVHWYGIMYLIGFLGAWWLGRFRAKRPASGWRPEQVDDLIFYGA
LGVILGGRLGYALFYDFDHILADPFAIFKIWQGGMSFHGGLLGVLVAMAVYARKAGKGFF
QVTDFVAPLVPIGLGAGRIGNFINGELWGKVTELPWGMVFPDPRAGGLPRHPSQLYEAAL
EGVALFLILWFFSRRPRPTMAVSGLFLFCYGLFRFAVEFVRVPDAHLGYLALDWLTMGQI
LSLPMVFIGMILLGWAYRKRSSTHSIKS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagttatccaaatattgacccagtcgccttttccttgggtccgctcaaggtccattgg
tatggcatcatgtatttaattggctttttgggtgcctggtggctaggtcgttttcgagcc
aagcgtcctgcttccggttggcgaccggagcaggtggatgatctgattttctatggtgcc
ctgggggttattcttggtggccggctgggatatgctctgttctacgattttgatcatatc
ctggcggatccttttgctatctttaaaatttggcaaggagggatgtctttccacgggggg
ctgctcggcgttctggtcgccatggcggtctatgcccgtaaagcgggcaaagggttcttt
caggtgacggattttgtcgcccccctggttcctattgggttaggcgcgggccgcattggc
aatttcatcaatggggagttgtggggtaaggtgacggaattgccctggggcatggtgttc
cctgatcccagggctggcggtctgccccggcacccctcgcaactgtacgaggcagctctg
gaaggagtggccctttttcttattttgtggtttttctcccgccggccccgccccaccatg
gcggtctcgggcctgtttctattttgctacgggctgtttcgctttgcggtggagtttgtg
cgcgtgccggatgcccatctgggttatttggccctggattggctgaccatgggacaaatc
ctaagtctgcccatggtttttatcggcatgattttactgggatgggcttatcggaagcgt
tcttctacccattcgataaaatcttag

DBGET integrated database retrieval system