KEGG   Nitrosococcus watsonii: Nwat_0336Help
Entry
Nwat_0336         CDS       T01266                                 

Definition
(GenBank) PhoH family protein
  KO
K06217  phosphate starvation-inducible protein PhoH and related proteins
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Nwat_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoH AAA_30 AAA_19 IstB_IS21 AAA_22 ResIII DEAD AAA
Motif
Other DBs
NCBI-ProteinID: ADJ27306
UniProt: D8K9L7
Position
350851..351927
Genome map
AA seq 358 aa AA seqDB search
MSAPLFHLRVRRKESGIYKYSVWAISIPLNEHPPSDRSESSDFVLEPADNQRLANLCGQM
DEHLRQIERGLGVEINNRGNFFQVLGNSPSVEAAGEVIRRLYDDADESPVTPAQVHLLLR
EAGNQENFPLEEQEEIVIRTRRGVVKGRNSRQIRYLRNILTHDISFGIGPAGTGKTYLAV
ACAVEALEKDQVRRVLLVRPAVEAGERLGFLPGDLAQKIDPYLRPLYDALYEMLGFERVA
KLIERHVIEVAPLAYMRGRTLNESFIILDEAQNTTIEQMKMFLTRLGYGSTAVVTGDITQ
IDLPKGQPSGLRHVIEVLKEVKGISFNFFQPRDVVRHPLVQRVVQAYERFGRSSGVES
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgcgcctttgttccatctccgagttcggcgcaaggaatcaggaatttataagtat
agcgtttgggctattagcatacccttgaacgaacaccctccttctgatcgttccgagagc
agcgatttcgtcctagaaccggcggataatcagcggttagccaatctttgtgggcagatg
gatgagcatctgcgccagatagaaagagggctgggggtagaaatcaataatcggggcaat
ttttttcaggtgcttggtaacagcccttcggtagaggccgctggtgaagtgataaggcgc
ctttatgatgatgccgatgaatctccggtgacccctgcccaggtccaccttcttttgcgg
gaagctggaaaccaggaaaatttccctttggaagagcaggaagaaatcgtgattcggacc
cgccgaggcgtggttaaaggccgcaactcgcgacaaattcgctatttacgcaatattctc
acccatgatattagcttcggtatcggtccagcagggacggggaaaacctatcttgctgtc
gcttgtgccgtggaagctttagaaaaagatcaggtgcggcgcgtgcttttagtgcggcct
gccgtagaagccggcgagcgtttaggattcctgccaggcgatctagcccagaaaatcgat
ccctatctgcgccctctctacgatgccctttatgaaatgttgggctttgagcgggttgct
aagcttattgagcgccatgtgattgaggtggctcctctagcgtatatgcgtggccgtact
ttaaacgaatcctttatcattttagatgaggctcaaaatacgacaatcgagcagatgaaa
atgtttctcactcgtttagggtatggctcaacggctgttgtgacgggcgatatcacccaa
atagatctgcctaaaggtcagccttcaggcttgcgccatgtcattgaagtattgaaggaa
gtcaaaggaattagctttaatttttttcagccgcgggatgtggtgcggcacccactggtg
caacgggtggtgcaagcctatgagcgttttggccgtagtagtggggtagagtcatga

DBGET integrated database retrieval system