KEGG   Nitrosococcus watsonii: Nwat_0338Help
Entry
Nwat_0338         CDS       T01266                                 

Definition
(GenBank) CBS domain containing protein
  KO
K06189  magnesium and cobalt transporter
Organism
nwa  Nitrosococcus watsonii
Brite
Transporters [BR:nwa02000]
 Other Transporters
  Others
   Nwat_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorC_HlyC CBS
Motif
Other DBs
NCBI-ProteinID: ADJ27308
UniProt: D8K9L9
Position
352395..353270
Genome map
AA seq 291 aa AA seqDB search
MNEGRPSHNLVSRSWRERLGQVLLGEPQDREKIIEILRNASQRRLLDPETLSMIEGALVV
GEMQVRDIMVPRSQMVVVERDAPPEDTLEVITRSAHSRFPVIGESRDGIVGILLAKDMLL
YCRQREARTFNIRDILRPVVFIPESKRLNVLLREFRASRNHMAIVVDEYGGTAGLVTIED
VLEQIVGEIEDEHDVAEDAFIFRRREDNYTVKALTPIEDFNEYFGTDFSDEEFDTIGGLV
LNGFGRMPERGETIVIGSFEFKVLRADSRRLHLLELRLKTNGVGNPVAAGA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaggccgacctagtcataatttagtatcccgttcttggcgagaacgtctgggg
caggtactgctgggcgaaccccaagatcgagaaaaaattatcgagattttacgtaatgct
tcccagcgccgcctccttgatccggaaactctgagtatgattgaaggcgctttagtggtg
ggggagatgcaggtgcgcgatattatggtgccgcggtcgcagatggtagtcgtggagcgg
gatgcgccgccggaagatactctggaggtgattactcgatccgcccattcccggtttccg
gtgataggtgagagccgggatggcattgtcggaatcctattggcgaaggatatgcttctc
tattgccggcagcgagaagcgcggaccttcaatattcgcgatattctgcgtccagtagta
tttattccagagagcaagcgtctgaatgttttgctaagggaatttcgtgcgagccgtaat
cacatggcgatcgttgtggatgaatatgggggaacggcagggctggtgaccatcgaagat
gtcttagagcaaatcgtaggcgagattgaagatgaacatgatgttgctgaagacgccttc
atctttcgccgcagggaagataattatacggttaaagcactcactcccatcgaagatttt
aatgagtattttgggaccgattttagtgatgaggaattcgataccattggcggtttggtg
ctaaatggattcgggcgaatgcctgaacggggggaaactattgttattggcagctttgaa
tttaaggttttgcgcgccgatagtcggcgcctccatttactagaattgcgcctgaaaacc
aacggcgttggaaacccggtggcagcgggggcttga

DBGET integrated database retrieval system