KEGG   Nitrosococcus watsonii: Nwat_0339Help
Entry
Nwat_0339         CDS       T01266                                 

Definition
(GenBank) apolipoprotein N-acyltransferase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Nwat_0339
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     Nwat_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase TruB_C
Motif
Other DBs
NCBI-ProteinID: ADJ27309
UniProt: D8K9M0
Position
353351..354916
Genome map
AA seq 521 aa AA seqDB search
MGYTPEQKPFYERVCQKKYFFSSSAGANTWCGDALALVAGLLGPLAFSPYDAYPLAVISP
ALLFAVCRNLSARRAFWRGWLFGVGWFGAGVSWIYVAIHDFGYASVPLALALTATFVAFL
GLFPALLTGGVTFWFPQENRAKYLLVWPAAWVMIEWFRGWFLTGFPWLNLGYSQIESPLR
GLAPIFGVYGVSLAVAFSAGLIVAAWRWALRARLIALGGLGTLWASALLLSLVPWTMPVG
KPLQVSLIQGNIPQAIKWQPEQIRSTLERYWQLTAKHWESDLIVWPESALTVLYHQVADG
YLAALAAEARAYNTDLLIGLPVFHQETGKYYNSMLSLGSQQAFYYKRHLVPFGEYIPFEE
YLRGLIHFFDLPMSSFSAGPKGQPLLQAAGYPVATSICYEDAFGEEIIAALPEANLLVNA
TNNAWYGDSLAPHQHLQISRMRALETGRDLARATTNGISAIVDAQGALLATTPQFQMAVL
TGSVQPRAGATPYILWGNGAVLGLCLCLFAIGSYYQRSKGS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggttacacgcctgagcagaagccattttatgaaagggtgtgccagaaaaaatacttt
ttctctagctcggcaggagcaaacacctggtgtggtgacgccttagccttggtagcgggg
cttctcggtccccttgccttttctccttatgatgcctaccctttagcggttatttctccc
gccttgttgtttgccgtatgccggaatttgtccgctcggcgggccttctggcgtggctgg
ttatttggagtaggatggtttggcgcgggcgtttcctggatttatgttgcgattcatgat
tttggctatgccagcgtaccgttagcgttggcgttgactgcaacgtttgtggcttttttg
ggtctttttccggcgttattgacaggaggcgttactttttggtttccccaggaaaataga
gctaaatatcttttggtatggccagcagcctgggtgatgatagagtggtttcgaggctgg
tttctgacgggtttcccatggctaaaccttggctacagtcaaatagaaagcccccttcgg
gggttggcgcctatttttggggtttatggtgtttccttggcggtagcttttagcgcaggg
ctgatcgtggctgcttggcgttgggctctgcgggcgcgcctgatagcccttggtggcttg
ggaactctatgggcttcggcactactgctctccttggtgccttggacgatgccggtaggc
aagccgctacaggtaagcttgatccagggaaatattcctcaggctattaaatggcagccg
gagcaaataaggtccactttagaacggtactggcagttgactgctaaacattgggagagc
gatctgatcgtttggccggagagcgcgcttactgtactttatcaccaggtggctgatggt
tacctggctgcccttgctgccgaggctcgggcctataatacagatttgctcattggcttg
ccggttttccatcaggaaacaggaaaatattataatagcatgctaagcctcggttcccag
caggcattctattataagcggcatttagtccctttcggcgaatatataccttttgaagaa
tatcttagaggactcatccactttttcgatttacccatgtcctctttcagtgctggcccc
aaggggcagcccttgctgcaggcggctggctacccggtagccacctccatttgttacgaa
gatgcttttggagaagaaatcattgcagcgttgcccgaagctaatttattggtgaatgct
accaataatgcctggtatggggattccttggcgcctcaccagcatctacagatttcccgg
atgcgcgccctggagacagggcgggacctagcccgagctactaccaatggtatctccgct
attgttgatgctcagggtgctttgctagccactactcctcagttccaaatggcggtactc
acaggtagcgttcaaccccgcgccggcgcgacgccctatatcctctggggtaatggcgct
gtcctagggttatgtttatgcttatttgccattggaagttattaccagcgtagcaaagga
agctag

DBGET integrated database retrieval system