KEGG   Nitrosococcus watsonii: Nwat_0340Help
Entry
Nwat_0340         CDS       T01266                                 

Definition
(GenBank) potassium uptake protein, TrkH family
  KO
K03498  trk system potassium uptake protein
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwa02000]
    Nwat_0340
Transporters [BR:nwa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Nwat_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkH DUF2834
Motif
Other DBs
NCBI-ProteinID: ADJ27310
UniProt: D8K9M1
Position
354924..356375
Genome map
AA seq 483 aa AA seqDB search
MQFAVVQRILGLLLALFSTAMLPPVIVSLFYQDGAGAEFLSAFVLILGIGLLCWLPVRNY
RQELRLRDGFIVVVMFWVVLSLSGALPLFLTAEPRLPFTDAVFESVSGLTTTGATVIIGL
DNLPKSVLFYRQELQWLGGMGIVVLAVAILPMLGIGGMQLYRAEIPGPMKTTKLTPRIAE
TAKALWLIYLGLTIACATAYWMAGMTLFDAVGHSFSTIAIGGFSTHDASMGYFNSPLIEM
IAVFFMLLAGVNFSLHFLAWRHRTVGHYWQDEEFRTYLSVLAGVAALTSSYLWLAHRFDS
PLLALQHGIFHAVSIGTTTGFTSSDYYGWPGFLPILLLMTSYIGGCAASTAGGMKVIRIL
LLYKQGAREIKRLIHPSAIIPIKIGSKSLPDRIVEGVGGFMAVYVACFIVMYLLLLATGL
DMITSFSAVTACLNNLGPGLGQVGAHYEVINAASKWVLCFAMLLGRLEIFTLLVILSPTF
WRR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgccgtggttcagcggattttagggttgttgttggccctatttagtaccgct
atgcttccgccagtcatagtgtccctgttttaccaagatggcgcgggggctgagtttcta
agcgcctttgttttgatactaggtattggtttgctgtgttggctaccggtacgtaattat
cggcaggagctgcggctgcgtgatgggtttatagtagtagttatgttctgggtggtttta
agcctttctggagctttacccctttttttaaccgctgagcctcgtttgccttttactgat
gctgtctttgagtccgtttctggcctgacgactaccggagctacggtaattatcgggctc
gacaacctgcctaaatcggtgttgttttatcggcaagaattacagtggctagggggtatg
ggcattgtggttttagcggtagctattttgcccatgctgggtattggtggcatgcagctt
tatcgggcggaaattccgggccccatgaaaacgaccaagcttactccccgtattgcagag
acggctaaagccctgtggttgatttacttaggtttgacgatagcttgcgcaaccgcttat
tggatggcaggtatgaccttgttcgatgccgttggtcacagtttttcaacaattgctatt
ggcggtttttctacccatgatgccagcatgggctattttaatagtccacttattgagatg
atcgcggtattttttatgctgcttgctggcgtcaatttttccctccattttcttgcctgg
cgtcatcggacggtaggccattactggcaagatgaggaatttcggacttatctatcggtg
cttgctggagtcgcagcattaacttccagttatctctggctagcacatcgtttcgacagt
ccacttttggccctccagcacggtatttttcatgcagtctctattggtactaccaccgga
tttacttctagtgactattatggctggcccggttttcttcctattctgctattgatgacc
agttatatcggtgggtgtgccgcttctaccgctggtggtatgaaagttattcggatttta
ttgctttataagcaaggggcgcgggagataaagcggttgattcacccaagcgccattata
cccatcaaaattggaagcaaaagcttaccggataggatcgtggagggggtaggcgggttt
atggcggtctatgtggcctgttttatcgtgatgtatttgctgttgctagcgacagggtta
gatatgattacctcattttcggcggtgaccgcatgtctcaataatttaggccctggattg
ggtcaagtgggcgctcattacgaggttattaatgccgcctctaaatgggtgttgtgtttt
gcgatgctgttgggccgcttagaaatttttaccctactggttattctgagcccaaccttt
tggcgtcgataa

DBGET integrated database retrieval system