KEGG   Nitrosococcus watsonii: Nwat_0504Help
Entry
Nwat_0504         CDS       T01266                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00540  Lipopolysaccharide biosynthesis
nwa01100  Metabolic pathways
Module
nwa_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Nwat_0504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:nwa01005]
    Nwat_0504
Enzymes [BR:nwa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Nwat_0504
Lipopolysaccharide biosynthesis proteins [BR:nwa01005]
 Unusual sugar
  Nwat_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADJ27469
UniProt: D8KAF4
Position
complement(521107..522060)
Genome map
AA seq 317 aa AA seqDB search
MIIVTGGAGFIGSNIIKALNQWGREDILVVDDLTQGEKFSNLVDCEIWDYWDKQAFLQAI
KAGEEFPHPVDVLIHQGACSATTEWDGRYMMENNFRYSTHLLHYCLERRIPFLYASSAAV
YGSGSIFREQREFETPRNVYGYSKWLFDQYVRRYLPTAPSQIVGLRYFNIYGSREAHKGT
MASVAYHAHCQLIETGRIKLFEGCDGYGHGEQRRDFVSVADAAAVNLWFLEHPNQSGIFN
VGTGQAQTFNEVAQAVLAFHGHGEIEYIPFPDHLRGRYQSFTQADTRALREAGYAESFAL
VEEGVTTYLRWLGENQN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgattattgttacaggcggcgctggctttattggcagcaatattatcaaggcgctcaat
caatgggggcgggaagatattctggtagtcgatgatttaacccagggagaaaaattcagc
aatttagtcgattgcgaaatctgggattattgggataaacaagcttttttgcaggcaata
aaggccggcgaggaatttccccatcctgtagatgtccttatacatcaaggtgcttgcagt
gccaccacggaatgggacgggcgctatatgatggaaaacaacttccgctactcaacacac
cttttacactattgcttagagcgccgtattcccttcctgtatgcctctagcgcggcagtc
tatggcagcggctccatttttcgggaacagcgcgaattcgagaccccgcgcaacgtctat
ggttattccaaatggctatttgatcaatatgtgcggcgttatctacccacagcccccagc
caaatcgttggcctccgttacttcaatatatatggttccagggaagcccacaagggcacc
atggccagcgttgcttatcatgcccattgccagctcatagaaacaggccgaatcaaactg
tttgaaggctgcgacggctacggacatggcgagcaacgacgtgattttgtctccgttgcg
gatgcagcggcggtcaacctttggtttctggaacatcccaaccaatccgggatttttaat
gtgggcacgggccaagctcaaaccttcaatgaggtagctcaggccgtactcgctttccat
gggcacggtgaaattgagtatatccctttccctgaccacttacggggacgttatcaaagt
tttacccaggccgatacccgtgctttgcgggaagcaggctatgccgaatctttcgccctg
gttgaagaaggggtgacaacctacctgcgttggctaggcgaaaatcaaaattaa

DBGET integrated database retrieval system