KEGG   Nitrosococcus watsonii: Nwat_1220Help
Entry
Nwat_1220         CDS       T01266                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00010  Glycolysis / Gluconeogenesis
nwa00052  Galactose metabolism
nwa00500  Starch and sucrose metabolism
nwa00520  Amino sugar and nucleotide sugar metabolism
nwa00521  Streptomycin biosynthesis
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
Module
nwa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_1220
   00052 Galactose metabolism
    Nwat_1220
   00500 Starch and sucrose metabolism
    Nwat_1220
   00520 Amino sugar and nucleotide sugar metabolism
    Nwat_1220
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nwat_1220
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Nwat_1220
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nwat_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADJ28151
UniProt: D8K5H4
Position
complement(1315727..1316734)
Genome map
AA seq 335 aa AA seqDB search
MKVLAADIGGTKTLLQIADWGENTPQVLAEQRYLSGDYSSFDDLLRTFLTETSSTGNGLR
GACFAVAGVVTQGVATATNLPWRLDATHLEATFELPQVVLINDFTAIGYGIEGLTPDDFA
ILQSGKPEAAAPQAVIGAGTGLGQALLVWQEQTGHYQVLPTEGGHVDFAPQGKLQIALLT
YLSRQLDHVSYERVLSGGGLVTLYHFLKETSGMAESPALKKALSEGDQAAAISRSALEHG
DPLAGQALDLLIQIYGAQAGNLALTCLPRGGLFVAGGIAPKIIERLQAGGFMEAFLSKGR
LSELMGQIPVKVILESKVGLLGASRLARRLAYEQL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattggctgcggatattggaggaaccaaaaccttacttcagatcgctgactgg
ggggaaaacactccgcaggttcttgcggaacagcgttatctcagcggtgattattcaagc
tttgatgatctcctgcgaacatttttgacagagacgagcagtacaggaaacggccttagg
ggtgcttgttttgctgtagcaggcgtcgtgacgcaaggcgtggcgacggccactaatctc
ccctggcggctggatgcaacacatttggaggcaacattcgagctgcctcaagtggtttta
atcaatgatttcacggccatcggctatggcattgaaggtctaacgccagacgatttcgca
atactccagtcaggcaagccggaagccgccgctccccaggcggttattggcgctgggacc
gggcttggacaggcattgctcgtatggcaggagcaaacgggtcactaccaggttttacct
actgaaggaggtcatgtagactttgcccctcagggaaaactccagattgcattgctgact
tatctttctcgtcagttagaccatgtttcctacgaacgggtattatcaggcggcggctta
gtcacgctctaccattttttgaaggaaaccagcggcatggctgaaagcccggccttgaaa
aaggcgttgagcgagggcgatcaggcagcggccatcagccgctccgctctggagcatgga
gacccattagcggggcaagcgttagatttactgatccaaatctatggcgcacaagcgggc
aatttagccctgacttgcttgccgcggggggggctttttgtcgccggcggtatcgcaccc
aaaattatcgagcgcttgcaggcgggcggatttatggaggcttttctaagcaaaggacga
ctgtccgagcttatggggcagatccctgtcaaagtcatattagagtccaaagttggcctg
ctgggagcctcgcgattagcaagaagattagcttatgagcaactatag

DBGET integrated database retrieval system