KEGG   Nitrosococcus watsonii: Nwat_1416Help
Entry
Nwat_1416         CDS       T01266                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00220  Arginine biosynthesis
nwa00330  Arginine and proline metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01130  Biosynthesis of antibiotics
nwa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Nwat_1416
   00330 Arginine and proline metabolism
    Nwat_1416
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Nwat_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADJ28326
UniProt: D8K5Z9
Position
1548602..1549528
Genome map
AA seq 308 aa AA seqDB search
MKIVRIIGAASGWGAPDRRCEAGPEVLRRRGLVAHLRRQGMPVAWEITVRPPENSVSAVA
AVQALSLELSQVTDNVVASGDPFVVLGGDHTCAIGTWSGVVSRWRIAEPVGLIWIDAHMD
AHLPETSPSGALHGMPLACLLGWGDPRLTAIGGPGPTFLPENVVLIGVRSFEPEEHQLLQ
RLGVKVFFMDEVRRRGLSEVFYEALEWVRDRTIAFGVSLDLDAIDPKEAPAVGSPVPGGL
AQEELLPLLRQLHGDFRLMGLEIAEYNPALDERQLTVRLIGELLLSVFAPSRLPYESYHR
AGKAVFSV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgttcgtatcattggtgctgcaagtggttggggcgcacctgatcgtcgctgc
gaagcaggtccggaggttctccgccgtcgaggtttagtagctcatctgcgccggcaagga
atgcccgttgcctgggagatcacggtacggccgccggaaaattcagtaagtgcggtggct
gcggtccaggcactttccctggaactgagtcaggtgaccgataatgtggttgctagtggt
gatccctttgtagttctaggaggcgatcacacttgcgctattgggacctggagcggagtc
gtttcaagatggcgaatcgcggaacccgtggggcttatctggatagatgcccacatggac
gctcatctgccagagaccagccccagtggtgctctgcacggcatgcctctggcctgtctg
ctaggctggggagatcctcggctcaccgccattggaggtcctgggcctacgttcttgcca
gaaaatgtggtgcttattggggtccgcagcttcgagccggaggagcatcaattgcttcaa
cgattaggggtaaaggttttttttatggacgaagtgcgccgtcgtgggttaagtgaagtg
ttttatgaggctttggaatgggtccgggaccggacgatagcatttggagttagtcttgat
ctggatgctattgatcccaaagaggcacctgctgtgggttctccagtgccagggggcctt
gcccaggaagaacttctaccgttgctgcggcagctccatggcgatttccgtttgatggga
ttagaaatcgctgaatataatcctgccttggatgagagacagctaacggttcgtctaatt
ggtgagctgctgctttcggtttttgccccatcgaggttaccctatgaatcctatcatcga
gctggaaaagcagtattcagcgtataa

DBGET integrated database retrieval system