KEGG   Nitrosococcus watsonii: Nwat_2112Help
Entry
Nwat_2112         CDS       T01266                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00040  Pentose and glucuronate interconversions
nwa00052  Galactose metabolism
nwa00500  Starch and sucrose metabolism
nwa00520  Amino sugar and nucleotide sugar metabolism
nwa01100  Metabolic pathways
nwa01130  Biosynthesis of antibiotics
Module
nwa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nwat_2112
   00052 Galactose metabolism
    Nwat_2112
   00500 Starch and sucrose metabolism
    Nwat_2112
   00520 Amino sugar and nucleotide sugar metabolism
    Nwat_2112
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nwat_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADJ28945
UniProt: D8K7R8
Position
complement(2312165..2313058)
Genome map
AA seq 297 aa AA seqDB search
MTKPITKVVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGIKVMVFVTGR
NKRPIPDHFDMAYELEAELERRGKNKLLKLVQDIIPKDVTCVYIRQEETLGLGHAVLCAA
PVVGEEPFAVILADDLIDAGTEGCLSQMVKQFSKHRCSLVGVEEVASDSTDQYGIIQPGL
AEGREYKVEGIVEKPKPAEAPSSLAVVGRYILTPRIFSLLEATPHGVGGEIQLTDALATL
LSEEYMFAYRFEGKRYDCGSKLGYLQATVEYGLKHAELGDSFRDYLRHLVAQAQSPL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacccattactaaggttgtattccctgtggcggggctggggactcgtttcctt
cccgcgaccaaagcaaatccgaaagagatgctgccaatcgtcgataagccgctcattcag
tatgcggttgaagaggcggttgaggcagggattaaggtgatggtttttgtgaccgggcga
aataagcgcccgatccctgatcatttcgatatggcttatgaacttgaagcagaattggaa
agacgcggcaaaaacaagctactcaaattggtgcaagacattattcctaaggatgtgacc
tgcgtttatattcgtcaggaggagacgttggggttggggcatgcggtgctctgtgccgca
ccagtcgtaggcgaggagccctttgcggtgatccttgccgacgatctgattgatgccggg
acggagggatgcctctcccaaatggtaaagcaatttagtaagcaccgttgcagcctcgtg
ggagtagaagaggtggcttctgatagcaccgatcaatacggtattattcagcctggcttg
gcggagggccgggagtacaaggtggaaggaattgtcgagaagcctaaaccggcagaggcg
ccttcatctctagcggtggtgggccgttatattttaaccccccgcatttttagtctctta
gaggctacccctcacggagttggaggcgaaattcaattgactgatgcccttgccacttta
ttgagcgaggagtatatgtttgcttatcgctttgaaggtaagcgctatgattgtggcagt
aaattgggctaccttcaggccacggtggagtatggcctcaagcatgcggagctaggtgat
tccttcagagactatttgcgccatctggttgctcaggcccagtccccgctttga

DBGET integrated database retrieval system