KEGG   Nitrosococcus watsonii: Nwat_2283Help
Entry
Nwat_2283         CDS       T01266                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00071  Fatty acid degradation
nwa00280  Valine, leucine and isoleucine degradation
nwa00310  Lysine degradation
nwa00362  Benzoate degradation
nwa00380  Tryptophan metabolism
nwa00620  Pyruvate metabolism
nwa00630  Glyoxylate and dicarboxylate metabolism
nwa00640  Propanoate metabolism
nwa00650  Butanoate metabolism
nwa00900  Terpenoid backbone biosynthesis
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
nwa01212  Fatty acid metabolism
nwa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nwat_2283
   00630 Glyoxylate and dicarboxylate metabolism
    Nwat_2283
   00640 Propanoate metabolism
    Nwat_2283
   00650 Butanoate metabolism
    Nwat_2283
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Nwat_2283
   00072 Synthesis and degradation of ketone bodies
    Nwat_2283
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nwat_2283
   00310 Lysine degradation
    Nwat_2283
   00380 Tryptophan metabolism
    Nwat_2283
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nwat_2283
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nwat_2283
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Nwat_2283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nwa04147]
    Nwat_2283
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Nwat_2283
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwat_2283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADJ29111
UniProt: D8K8J1
Position
2484218..2485522
Genome map
AA seq 434 aa AA seqDB search
MEPGGQRSLPRPVYIVDGTRTPFLKARGKPGPFTATDLAVAAGRPLLARQPFEPEALSEV
ILGCVMPGPDEANIARVAALRLGIQEHIPAWTVQRNCASGMQALDCAALDIANGRASLVL
AGGVEAMSHAPVLLSRPLVDWLGDWNRARNIKSRLRLLGRLRPYHLRPIMGLLRGLTDPV
VGLSMGQTAEVLASRFAIDRQTMDAYALASHQRLAHAQDSGWLSEVIPLFATNGQFFEHD
DGLRRDTSMAQLSKLKPVFDRPYGLVTAGNSAQVTDGACWLLLASEQAVTQHQLPVIGRI
VDSQWAALDPAQMGLGPVHATTPLLQRHQLSLNDLDAWELNEAFAAQVLACLAAWQDSDY
CRDELGLKETLGELDRKRLNVDGGAVALGHPVGASGARIVLHLLHVLKRLNGQRGIATIC
IGGGQGGAMLLERG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaggtggacaacgctccctgccccggccagtctatattgtcgatggcactcgg
actcccttccttaaagcccgagggaaacccggtccctttaccgcaactgacctagcggtc
gctgcaggccgtccattgctcgcccgccagccctttgagcccgaggcgttgagcgaagtt
atcctaggttgtgtcatgcctggtccagatgaggccaacattgcccgggtggctgcctta
cgcctaggtattcaggagcatatccctgcctggaccgtgcaacgtaattgtgcctcgggc
atgcaggcgctcgactgcgcggccctggacatcgccaatggtcgtgcgagcctagtactg
gctggcggggtagaagccatgagccacgcgccggtactgttaagccgtcccttagtggat
tggctaggagattggaatcgagcccgtaatatcaaatctcgtttacgcctactggggcgt
ttacgcccctatcacctgcgtcctattatgggtctattacggggattaacggatcccgtg
gtggggctttccatgggacaaacggcggaagtccttgccagtcgcttcgccatcgaccgc
cagaccatggatgcttatgctcttgcaagccatcagcgcttggctcacgctcaggacagc
ggctggctaagcgaagtgattccactgttcgccaccaatggccagttttttgaacacgac
gacgggctacgccgagacacctcgatggcccagctcagcaagctcaaaccggtttttgac
cgtccctacggcctggtaactgccggcaatagcgcccaagtcacagacggcgcttgttgg
ctgctgttggcttcggagcaagcggttacccaacatcaacttccagtaatagggcgcatt
gtagatagccaatgggccgcattagatcctgcccagatggggctaggtcctgtgcatgcc
acaaccccgttgctgcaacgccatcaactcagcctcaatgacctggatgcctgggaatta
aacgaagcctttgcggcccaggttctagcctgtttggcagcttggcaagattcagactac
tgccgcgatgaacttggtttgaaagaaaccctcggcgaattggatcgaaaacggctcaat
gtagatggaggagctgttgctctgggccatccagtcggtgctagcggggcccgcattgtc
ctgcacttgctgcatgtcttgaaacgcctcaatggccagcgcggtatcgccaccatttgc
attggcggaggccaaggtggtgctatgctattagaaagggggtaa

DBGET integrated database retrieval system