KEGG   Neisseria weaveri: SAMEA3174300_0902Help
Entry
SAMEA3174300_0902 CDS       T04355                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nwe  Neisseria weaveri
Pathway
nwe00071  Fatty acid degradation
nwe00072  Synthesis and degradation of ketone bodies
nwe00280  Valine, leucine and isoleucine degradation
nwe00310  Lysine degradation
nwe00380  Tryptophan metabolism
nwe00620  Pyruvate metabolism
nwe00630  Glyoxylate and dicarboxylate metabolism
nwe00640  Propanoate metabolism
nwe00650  Butanoate metabolism
nwe00900  Terpenoid backbone biosynthesis
nwe01100  Metabolic pathways
nwe01110  Biosynthesis of secondary metabolites
nwe01120  Microbial metabolism in diverse environments
nwe01130  Biosynthesis of antibiotics
nwe01200  Carbon metabolism
nwe01212  Fatty acid metabolism
nwe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA3174300_0902 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMEA3174300_0902 (thlA)
   00640 Propanoate metabolism
    SAMEA3174300_0902 (thlA)
   00650 Butanoate metabolism
    SAMEA3174300_0902 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMEA3174300_0902 (thlA)
   00072 Synthesis and degradation of ketone bodies
    SAMEA3174300_0902 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMEA3174300_0902 (thlA)
   00310 Lysine degradation
    SAMEA3174300_0902 (thlA)
   00380 Tryptophan metabolism
    SAMEA3174300_0902 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMEA3174300_0902 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMEA3174300_0902 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMEA3174300_0902 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nwe04147]
    SAMEA3174300_0902 (thlA)
Enzymes [BR:nwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMEA3174300_0902 (thlA)
Exosome [BR:nwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMEA3174300_0902 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: SAY51018
UniProt: A0A181CHE8
Position
1:complement(984998..986179)
Genome map
AA seq 393 aa AA seqDB search
MIRDVVIVAAKRTAVGSFMGGLSALRAPELGAAVIRDLLLQTGVAADEVDEVVMGHVLTA
GVGQNPARQAAMLAGLPVEIPATTVNVVCGSGLKAVQMAAQAVACGDAEIVIAGGQESMS
QSPHFVRMRSGIKMGDAGLTDSMVSDGLTDVYHQYHMGITAENIAERLHISREAQDIFAL
QSQQKAVQARSSGKFAEEITAVAVPQRRGEAVWFDQDEYIKADASAEKLAALRPAFKKDG
TVTAGNASGLNDGAAAVMVMSLEKAEALGLKPLAFIRAYAATGIEPEMMGLGPVAAIGKT
LQKAGWTVGDVDLFEANEAFAAQALGVMQQAGLPSEKINVNGGAIAIGHPIGASGCRILV
TLLHEMRRSNKRKGVAALCAGGGMGLALAVERE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgatgtggtgattgttgccgccaaaagaacggcggtcggcagttttatgggc
ggtttgtctgctttgcgtgcgccggaattgggtgcggcggtgattcgggatttgctgttg
cagacaggcgtagcggcagatgaagtggacgaagtggtgatgggccatgtgctgacggcc
ggtgtcggtcagaatcctgcccgtcaggctgcgatgttggccggattgccggtggaaatt
ccggcaacaacggtgaatgtggtatgcggttccggtttgaaagcagtgcagatggctgcc
caggccgtggcctgcggcgatgcggaaatcgtgattgccggcgggcaggagtcgatgtcg
caaagtccgcactttgtccgtatgcgcagcggtatcaaaatgggcgatgccggcttgacc
gacagcatggtttcagacggcctgaccgatgtgtaccatcaataccatatgggtattacg
gcggaaaatatcgcagagcgtctgcatatttcccgggaagcacaagacatttttgccttg
cagtcgcaacaaaaagcggtgcaagcccgaagcagcggcaaatttgccgaggaaatcact
gccgttgccgtgccgcagcgtcggggcgaagcggtgtggtttgatcaagacgaatacatt
aaagccgatgcttcggcggagaaactggcggccttgcgtcccgcatttaaaaaagacgga
acggtaacggcaggcaatgcttcgggtttgaacgacggtgcggcagcggtaatggtgatg
agtttggaaaaagccgaagcgctcggattaaagccgctggcctttatccgcgcctatgcg
gccaccggtatcgagcctgaaatgatgggtttggggccggtggcggccatcggcaagact
ttgcagaaagccggttggacagttggcgatgtcgatttgtttgaagccaatgaagcgttt
gccgcccaagcgttgggtgtcatgcagcaggcaggattgccgtctgaaaaaatcaatgtc
aacggcggtgcgattgccataggtcatcctatcggtgcttcgggctgccgtattttggtg
acgttgctgcacgagatgcgccgcagcaataagcgtaaaggcgtggcggcattatgtgcc
ggcggcggtatgggattggcattggcggtagaaagggagtaa

DBGET integrated database retrieval system