KEGG   Neisseria weaveri: SAMEA3174300_1187Help
Entry
SAMEA3174300_1187 CDS       T04355                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
nwe  Neisseria weaveri
Pathway
nwe00740  Riboflavin metabolism
nwe00790  Folate biosynthesis
nwe01100  Metabolic pathways
nwe01110  Biosynthesis of secondary metabolites
nwe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nwe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAMEA3174300_1187 (ribA)
   00790 Folate biosynthesis
    SAMEA3174300_1187 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAMEA3174300_1187 (ribA)
Enzymes [BR:nwe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAMEA3174300_1187 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: SAY51295
UniProt: A0A448VKB3
Position
1:complement(1282037..1282639)
Genome map
AA seq 200 aa AA seqDB search
MTDTQRLKFVAECRLPTELGEFTLHGFEDAGTGQEHVALSMGDISNGEPVLVRVHSECLT
GDALFSQKCDCGPQLQAAMMAVRQEGRGVIIYLRQEGRGIGLINKIKAYRLQDQGMDTVE
ANVALGLPVDARDFRLAKDILDHLGVKDIKLLTNNPQKVGVLVAAGINVVERLPIVVGLN
PENSHYLNVKAEKLGHKYTL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacccaaagactgaaatttgttgccgagtgcagactgcctaccgaattggga
gagtttacgctgcatggatttgaggatgcgggaaccggtcaagagcatgtggcgctgagt
atgggtgacatatccaacggcgagccggttttggttagggtgcattcggaatgtttaaca
ggtgatgcgttgttttcccagaagtgtgattgtggtccgcaacttcaagctgcaatgatg
gctgtccggcaagagggaaggggtgtgataatttatttgcgtcaagaaggacggggtatc
gggctgattaataaaattaaggcatatcgattgcaagatcagggcatggatactgttgaa
gctaatgttgcgttgggtttgcctgtggatgcccgggattttagattggctaaagatatt
ttggaccatttgggcgttaaggatattaaattgctgacgaataatccgcagaaagtcgga
gtgttggttgcggccggaattaatgttgtcgaacgcctgcctattgtggtagggcttaat
ccggaaaacagccattatttaaacgtgaaagctgagaagcttggtcataagtatactttg
taa

DBGET integrated database retrieval system