KEGG   Neisseria weaveri: SAMEA3174300_1884Help
Entry
SAMEA3174300_1884 CDS       T04355                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nwe  Neisseria weaveri
Pathway
nwe00790  Folate biosynthesis
nwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAMEA3174300_1884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nwe04147]
    SAMEA3174300_1884
Enzymes [BR:nwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     SAMEA3174300_1884
Exosome [BR:nwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMEA3174300_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a zf-3CxxC Cauli_VI
Motif
Other DBs
NCBI-ProteinID: SAY51956
Position
1:2021762..2022106
Genome map
AA seq 114 aa AA seqDB search
MNDLAKQQCEACRADAPKVSDEELAELIRMIPEWQPVVIDGVLQLKREYTFKNFKQAMAF
SNRLADLAEAEGHHPGIFTEWGKVTVTWWSHSIKGLHRNDFIMAAKTDELSAAE
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttagccaaacagcaatgcgaagcctgccgtgccgacgcgccgaaagtgagc
gatgaagaactggcggaattgatccggatgattcccgaatggcagccggtggtgattgac
ggcgtattgcagttgaaacgcgaatacacattcaaaaacttcaagcaggcgatggcattc
agcaaccgcttggcggatttggccgaagccgaaggccatcatcccggcatttttaccgaa
tggggaaaagttaccgtaacttggtggtcgcacagcattaaaggtctgcaccgcaatgat
tttattatggcggcaaaaaccgacgagttgtcggctgccgaataa

DBGET integrated database retrieval system