KEGG   Neisseria weaveri: SAMEA3174300_1932Help
Entry
SAMEA3174300_1932 CDS       T04355                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nwe  Neisseria weaveri
Pathway
nwe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nwe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAMEA3174300_1932 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nwe03011]
    SAMEA3174300_1932 (rplV)
Ribosome [BR:nwe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAMEA3174300_1932 (rplV)
  Bacteria
    SAMEA3174300_1932 (rplV)
  Archaea
    SAMEA3174300_1932 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: SAY51999
UniProt: A0A3S5AAZ4
Position
1:2067638..2067967
Genome map
AA seq 109 aa AA seqDB search
MRVSAQHKNARISAQKARLVADMIRGKNVAQALSILTFSPKKGAELIKKVLESAIANAEH
NNGADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaagtgcacaacataaaaacgctcgtatttctgcacaaaaagcacgcttagtt
gcagatatgattcgtggtaaaaatgtagctcaagctttaagtattttgacatttagtcca
aaaaaaggtgctgagttaatcaagaaagttttggaatcagctattgcgaatgcagagcat
aataatggcgctgatattgatgaattaaaagtagtgactatttttgtggataaaggacct
agtctgaaacgattccaagcacgagctaaagggcgtggtaatcgtattgaaaaacaaact
tgtcatattaatgtaacagtaggtaactga

DBGET integrated database retrieval system