KEGG   Neisseria weaveri: SAMEA3174300_2056Help
Entry
SAMEA3174300_2056 CDS       T04355                                 

Gene name
cysP
Definition
(GenBank) transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nwe  Neisseria weaveri
Brite
KEGG Orthology (KO) [BR:nwe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SAMEA3174300_2056 (cysP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: SAY52113
UniProt: A0A448VP43
Position
1:complement(2183266..2184843)
Genome map
AA seq 525 aa AA seqDB search
MTQAQTSVSMKRINLIFASLLIIAVGYFIFWGIGYTNNNHTILFLLATLFGVFMAFNIGG
NDVANSFGTSVGAGTLTVPQALVIAAIFEVSGAVIAGGEVTNTIRKGVIDLKVMNLEPMQ
FVYIMMSALLAAALWLLFATKRGLPVSTTHAIIGGIVGSALCLGFLTNGSDAFGLVQWDN
MAQIAISWVLSPVLGGLVSYILFAQIKKHVLDYNTKAEQTLKSIKQEKKSYKEQHKLFFE
GLSEVEKVECASQMARDAQIYGEPDLDPNELESVYYKGLYKIDSRKHNLDVYKALHSWVP
IIASIGGMMIASMLIFKGLKNLQLGMSNMGSFLTIFMVGAAIWMATFIYGKTLKRKDLSK
STFLMFSWMQVFTAAGFAFSHGANDIANAIGPFAAIMDVLRTGDVGAQAPVPPIAMLTFG
IALIVGLWFIGKEVIQTVGTSLAEMHPASGFTAELAAAAVVMMASLMGLPVSSTHILVGA
VLGIGLVNRNANWAMMKPIGLAWVITLPAAAILSVICFLILRNVF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggctcaaacgagtgtaagcatgaaaagaatcaatctgatctttgcatcacta
ctgattattgctgtgggatattttattttctggggaatcggatacacaaataacaaccac
accatactctttctgctggctactctgttcggcgtttttatggccttcaatatcggcggt
aacgacgttgccaactctttcggcaccagcgttggcgcaggtacgctgactgttccacag
gctctggttatcgctgcgatttttgaagtcagcggtgccgttatcgccggcggagaagta
accaacaccatccgcaaaggcgtgattgacttaaaggtcatgaatcttgagccgatgcag
tttgtttatatcatgatgtccgccctgcttgccgctgccttatggctgctgtttgcaacc
aaacgcggccttcccgtttccactacccatgccattatcgggggtattgtcggcagcgca
ttgtgcctgggcttcttaaccaacggttccgatgctttcggcctggttcaatgggacaac
atggcgcaaattgccatttcttgggttttatcccccgtattgggcggtttggtttcttat
attttgtttgcacaaatcaaaaaacacgttctcgattacaacaccaaagccgaacaaact
ttaaaatccatcaagcaagaaaagaaatcctataaagaacagcacaagctgtttttcgaa
ggcttgagtgaagtagaaaaagtcgaatgcgcctcccaaatggcacgtgatgctcaaatt
tacggcgagcccgacttagatccgaacgaactggaatcggtatactacaaaggcctctac
aaaatcgacagccggaaacacaatttagacgtatacaaagccctacattcttgggtaccg
attatcgcctctatcggcggcatgatgatcgcatccatgctgatcttcaaaggcctgaaa
aacctgcagctgggcatgagcaatatgggcagtttcctgaccattttcatggtaggcgca
gcaatttggatggcaacattcatctacggcaaaaccctgaaacgtaaagatctcagcaaa
tcaaccttcctgatgttcagttggatgcaggtatttaccgcagccggttttgctttcagc
cacggcgcaaacgacattgcgaacgccatcggcccgtttgccgccattatggacgtattg
cgtaccggcgatgtaggtgcacaagctccggttccgccgattgccatgctcacattcggt
atcgccttgattgtcggcctatggtttatcggtaaagaagttatccaaaccgtcggcacc
agtttggcagaaatgcatcccgcttccggttttaccgcagaattggctgcagcagccgtt
gtaatgatggcttcgctgatgggtctgcccgtttccagtacccatattttggtaggcgcg
gtattgggcatcggcttggttaaccgcaacgccaattgggcgatgatgaagcccatcggt
ttggcttgggtgattacccttcctgccgccgccatcctatcggttatctgcttcctgatt
ttaagaaacgtattctga

DBGET integrated database retrieval system