KEGG   Nitrobacter winogradskyi: Nwi_0054Help
Entry
Nwi_0054          CDS       T00276                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00260  Glycine, serine and threonine metabolism
nwi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01130  Biosynthesis of antibiotics
nwi01230  Biosynthesis of amino acids
Module
nwi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwi_0054
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nwi_0054
Enzymes [BR:nwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nwi_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ALF YgbB PcrB
Motif
Other DBs
NCBI-ProteinID: ABA03322
UniProt: Q3SWL9
Position
complement(66066..66902)
Genome map
AA seq 278 aa AA seqDB search
MTTRIDTRFAELRKQGRSAFVTFLMAGDPDPATSLAIIKALPRAGADIIEIGMPFTDPMA
DGPAVQAAGRRALDAGMTLTGTLRMIGEFRKDDDSTPVVLMGYYNPVYIYGVEKFLDDAR
AAGVDGLIVVDLPPEEDSELCIPAMKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGSAAADSTAVGAAVGRIKRHTSLPVCVGFGIRTPDAARGIAERSDGAVVGSALVDA
LSASLDAEGKATSGTVQAVASLAAALAEGVRSARQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacccgtatcgacacgcgcttcgccgagttgcgcaagcagggacgctcggccttc
gtcacttttctgatggccggcgatccggaccccgcgacctcgctcgccatcatcaaggcg
ttgcccagggccggcgccgacatcatcgaaatcggaatgcccttcaccgatccgatggcg
gatggtccggcggtccaggcggccgggcggcgcgcgctcgatgcgggcatgaccctgacc
ggcacgctgcggatgatcggcgagtttcggaaggacgacgattcgacgccggtcgtgctg
atgggctattacaatccggtctacatctacggcgtcgagaaatttcttgacgatgccagg
gcggcgggcgtcgatggcctgatcgtcgtcgacctgccgccggaggaagactccgagttg
tgcatcccggcgatgaaagccggattgaatttcattcgcctggcgacgccgacgacggat
gacaagcgtctgccggcggtgctcgcgaatacgtcgggttttgtgtactacgtctcgatc
accgggatcaccggcagcgcggcggcggattcgacggcggttggcgcggcggtcgggcgc
atcaagcgccatacgagcctgccggtctgcgtcggcttcggcatccgcactccggatgcc
gcgcgcggcattgccgagcgctcggacggcgcggtggtcggctcggcgctggtcgatgcg
ctcagcgccagcctcgacgccgaaggcaaggcgacgtccggaaccgtccaggcggtcgcc
tctctcgcggcggcgctggccgagggcgtgcggtcggcgcggcaagcagcggaatag

DBGET integrated database retrieval system