KEGG   Nitrobacter winogradskyi: Nwi_0472Help
Entry
Nwi_0472          CDS       T00276                                 

Definition
(GenBank) uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00860  Porphyrin and chlorophyll metabolism
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nwi_0472
Enzymes [BR:nwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nwi_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABA03739
UniProt: Q3SVF2
Position
529085..529831
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPEPDNETTASALRAMGREALLSPVLRFEAAAFEIDRGANYGAVIVTSANALRA
LAVHPGIESLLKLAVFAVGRHTAEAARRVGFQDVVAAAGDAAALCELIVKRVRAKSLPKG
ARILYLAAADRSCDLAGKLEGHGLAVVTTTCYRMAPVASLSREVCDAFAAHRISAVLHYS
RRSARAFLDAVRIGGVEISALAVPQCCISGAVASVLRDAGAPHVVEASAPAEEAVLEALD
CALRPASQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttctcgtcacacggcctgaaccggacaatgaaaccacggcgtcggcgctgcgt
gcgatggggcgcgaggcgttgttgtcaccggtgttgcgcttcgaggcggctgctttcgaa
atcgaccggggcgcgaattatggcgcggtcattgtcaccagcgccaacgcgctgcgcgcg
ctcgccgtccatccggggattgaatcgctgctgaagctggccgtgttcgcggtcggccgt
cacaccgccgaggccgcgcgccgggtcggcttccaggatgtggtggcggcggccggagac
gccgcggcattgtgcgaactcatcgtgaagcgtgtccgcgcgaaatccctgccgaagggc
gccaggattctctatctcgccgcggctgaccgctcatgcgatctcgcggggaagctcgaa
gggcacggtttggccgtcgtgacgacgacatgttaccggatggcgccggtggcgagcctg
tcccgcgaggtctgtgacgcgttcgccgcgcaccggatatcagcggtgctgcattattcg
cgccgcagcgcccgtgcgttcctggatgccgtccggatcgggggcgtcgagatatcggcc
ctggcggtcccgcaatgttgcatctcgggcgcggtcgcctccgttctgcgggatgcaggc
gcgccccatgtggtggaggcgagcgccccggcggaggaagctgtcctggaggcgttggat
tgtgcgttgcggccggcgtcgcagtaa

DBGET integrated database retrieval system