KEGG   Nitrobacter winogradskyi: Nwi_1499Help
Entry
Nwi_1499          CDS       T00276                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2147
Motif
Other DBs
NCBI-ProteinID: ABA04760
UniProt: Q3SSI1
Position
1628607..1629425
Genome map
AA seq 272 aa AA seqDB search
MNFRTGVDPMKALGVAAALLLTLSTAQAGENFSFEIGGHTVRIHASRGCDSPSCISISIP
GLYNSKRKRFDDADSGDSDVPQAGSVQAPAASSPSAPPPAPAQASATASAPAPAATAPTP
AQQPSPSIAVSTPTASTGAPVEPVPSQDTKTVASNVPAAEPPEASPRATEPAGPLGMWVT
EKKEGRVRIEECGKNLCGYSVDSRSGRNKEKILINMKPSGSKWSGKIYDPNSGSTYSSTV
AMKGKDRLRVQGCAFGGMFCGGQIWTRLNQSL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccgaaccggagtggatcccatgaaagcgctcggtgtcgccgccgccttgttg
ctcaccctctcgaccgcccaggccggtgagaatttttcatttgagatcggtggacacacc
gtgcggatccatgcctcgcgcggatgcgactccccgtcctgcatctcgatctcgatccct
ggcctgtacaactcgaaacgcaaacggtttgacgacgccgattccggtgactctgatgtc
cctcaggcaggctccgttcaggcccctgccgcctcttccccgagcgcgccgccaccagcg
cccgcgcaagcatctgctacggcttctgccccggctcccgcggcaacagcgcctaccccc
gcgcaacagccctcgccttcgatagcggtgtctacgccgaccgcctcgactggggcgccg
gtggagcctgtcccgagtcaggacacgaaaacggtggcgtccaacgtaccggccgcggaa
ccgcccgaggcatcgcctcgtgccaccgaaccggccgggcctctcggcatgtgggtaacc
gaaaagaaggaaggccgcgtccggatcgaggagtgcggcaaaaatctgtgcggatattcc
gtggattcccgcagcggccggaacaaggagaagatcctgatcaatatgaagccgagcggc
tcgaagtggagcggaaagatctacgacccgaacagcggaagcacctacagttccaccgtt
gcgatgaagggcaaggaccgcctgcgcgtccagggttgcgcattcgggggcatgttctgc
ggtggacaaatctggacccggctcaaccagagcttatga

DBGET integrated database retrieval system