KEGG   Nitrobacter winogradskyi: Nwi_1512Help
Entry
Nwi_1512          CDS       T00276                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA04773
UniProt: Q3SSG8
Position
1641947..1643176
Genome map
AA seq 409 aa AA seqDB search
MSQQGPLIVVSHGERQASVVSRASRSIFPVLDIDWSEASRGIERFQPAAVFVPTTEGAGV
GLDRLAGQLAAMQPYVPLIVADPPMPCPDNALPFSSLNEGIDRFDRRLNAALRVRTLHAT
VLRRLAGNPAAPSLPDADPIRDATVLLIGRGAAYPTLSVAFGERLGVVGALSIEAAAKHL
NARDLDGVVISEGFARRVVDALLTVLAEDTRFRNLPIAVPAGGPWATYDLPNLEVMPSEP
HHAVSTFLPLVRQHAFEARLHRTLKSMDAGGLLDPRTGLLTGDAFHRELNMAIRQTRSSG
ASLSIARFSLGQQHERPLFDAARILSRLMRRMDFGTLEADGSIVVVFADADLRNAQMIAR
RLSSVMKHTTLSAKRTVRIDPQVTLTASRFDDSAVSLLTRLSSEARAAS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcaaggcccgcttatcgttgtctcacacggcgagcgacaagcgtccgtcgtc
tctcgagcgagccggagcatcttccctgttctcgacatcgattggtcggaagcctcccgc
ggcatcgaacgctttcagccggcagccgtgttcgtccccacgaccgaaggcgcgggcgtg
ggattggatcgcctcgccggtcagcttgccgcgatgcagccttacgttcccctgatcgtc
gccgatcccccaatgccctgcccggacaacgcgcttccgttctcgtccctgaacgaaggc
atcgaccggttcgacaggcgtctcaatgcggcgctgcgcgtgcgaacgctgcacgcgacc
gtcctccggcggcttgcaggcaatccggcggcgccaagcctgccggatgccgacccgatc
cgggatgcgaccgttctcctgatcgggcgcggcgccgcttatccgacgctatcggtggcc
tttggcgaacggctcggcgtcgtcggggcgctcagcatcgaggcggcggcgaagcatctc
aacgcgcgggatctggacggtgtcgttatcagtgaggggttcgcccggcgcgtggtcgac
gcgcttctgaccgtgctcgctgaagacacgcgctttcgcaatctgccgatcgcggttccg
gccggcggcccgtgggcgacctatgatcttcccaatctcgaagtgatgccgagcgagccc
catcatgccgtcagcacgtttctgcctttggttcggcagcacgcattcgaggcgcgtctg
catcgtacgctgaaatcaatggatgcgggcggactcctcgatccgcgaacgggtctcctg
accggggatgccttccaccgtgaactcaacatggcgatccgccagacccgctccagcggc
gcgagtctctccatcgcgcgcttctcgctcggccagcagcatgaacgcccgctgttcgac
gcggcgcgtattctcagccggctgatgcggcgaatggatttcggcacgctcgaagccgat
ggttcgatcgtcgtggtttttgccgacgctgatttacgcaacgcgcagatgatcgcgcgg
cggctttcgagcgtgatgaagcatacgacgctcagcgccaagcgtaccgtgcggatcgac
cctcaggtcaccctgacggcatcccggtttgatgactcggcggtatcgctcctcacccgc
ctgagcagtgaagcgcgcgcggcatcataa

DBGET integrated database retrieval system