KEGG   Nitrobacter winogradskyi: Nwi_1515Help
Entry
Nwi_1515          CDS       T00276                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Nwi_1515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nwi03400]
    Nwi_1515
Enzymes [BR:nwi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Nwi_1515
DNA repair and recombination proteins [BR:nwi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Nwi_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C DEAD RecG_wedge ResIII SecA_DEAD AAA_30 tRNA_anti-codon AAA_25 GIDE PhoH TsaE DUF2075
Motif
Other DBs
NCBI-ProteinID: ABA04776
UniProt: Q3SSG5
Position
1647153..1649252
Genome map
AA seq 699 aa AA seqDB search
MRPALLNPLFVPVTSLSGVGPKQDRLFRHLLARDETPRLVDLLFHLPASVVDRRARPKIR
DAVPGTIVTLEVSVDRHRPAPPGRSRAPHLVYASDETGSVVLTYFRAQPSYVEKLLPAGS
KRYVSGTVQMFDGTLQIVHPDRVVDEAGLAELSGIDPVYPLTQGLAPGALRRAIAQALQN
LPVLPEWTDPKILRRCGFPPLAQALRRVHVPLELTDTLPEGPFWSRLAFDELLAGQLALT
LVRARLRRPAGNRHAGDGHLRNRIIDALPYALTASQQQAVAAIIEDLRQPVRMLRLLQGD
VGSGKTVVALLAACAVAESGKQTALMAPTEVLARQHIKTIAPLAERAGLRVAILTGREKG
RERREITARLAEGDIDLLVGTHALIQDEVTFKSLALAVVDEQHRFGVRERLALTTKGEAV
DVLVLSATPIPRTLVLTYFGDMDVSELRDKPAGRQPIDTRAVSDGRLTEVIDAVGRAVKA
GKLAYWICPLVEESDAVDLSDAEQRYQSLKARFGDRVGLVHGKMRGPEKDRVMAQFAAGE
INLLVATTVVEVGVDVPAATIMVIENAERFGLAQLHQLRGRIGRGSEPSTCLLLYREPLG
EMSAARLRVIRETTDGFRIAEEDLRLRGEGDVLGTRQSGLPGYRVARSDVHAQLITLARD
EALRILKQNPNLTGSHGEALRCLLYLFERDEALPLLGAG
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccgcgctgctcaatccgctctttgtaccggtgaccagcctgtccggcgtcgga
ccgaagcaggacaggctgttccggcacctgctcgcgcgcgatgaaacgccgcggctggtt
gatctgctgtttcacctgcctgcaagcgtcgtcgatcgcagggcgcgacccaaaatccgt
gacgccgtccccggcacgatcgtgacgctggaggtgagcgtcgaccggcatcgcccggcg
ccgcccggacgctcgcgcgcgccgcatctcgtctatgccagcgacgaaaccggaagcgtc
gtcctgacctacttccgcgctcagccgagctatgtcgaaaaactgcttcccgcaggcagc
aagcgttatgtgtccggcacggtgcagatgttcgacggcacgctgcagatcgtgcatccc
gaccgggttgtcgatgaagccgggctggcggagctttccggcatcgatcccgtctatccc
ctcacccagggtctggcgccgggggcgttgcgccgcgcgatcgcgcaggcattgcagaat
ctgcccgtgttgcccgaatggaccgatccgaagattttacgtcgctgtggctttccgccg
ctggctcaggcgctccgccgggtccacgtccccctggagttgactgatacgctgccggaa
ggcccgttctggtcacgcctcgccttcgacgaactgctggccggccagcttgcgctaacg
ctggtgcgcgcgcggcttcgccgcccggctggaaaccggcacgcgggcgacggacacctg
cgcaacaggattatcgatgcgctcccctacgccctcaccgcatcccaacagcaagccgtc
gcggcgatcatcgaagacctgcggcagccggtgaggatgctgcggctgcttcagggcgat
gtcggctcgggcaagaccgtggtcgcgctgctggccgcctgcgcggtggccgaatccggc
aagcagacggccttgatggcgccgaccgaggttcttgctcgccagcatatcaagaccatc
gcgccgctggccgaacgggccggcctgcgggttgcgattctgaccggccgcgagaaaggc
agggaacggcgcgagatcacggcgcgcctcgccgaaggcgacattgacctgcttgtaggc
acccatgcgttgatccaggatgaggtcacgttcaaatcgctggcgctcgcggtggtggat
gagcagcaccgtttcggcgtgcgcgagcgcctcgcgctgacgacgaagggtgaagctgtc
gatgtcctggtgctgagcgcgacgccgatcccgcgcacgctggtgctgacctatttcggc
gacatggatgtctccgaattgcgcgacaagcccgcgggccggcagccgatcgatacccgc
gccgtttccgacggccggttgaccgaggtcatcgacgccgttggccgcgccgtgaaggcg
ggaaagctggcttactggatctgtccgctggttgaggaatccgacgccgtcgacctgagc
gatgccgagcagcgctaccaaagcctcaaggctcgcttcggcgacagggtcggccttgtt
cacggcaagatgcgcggccccgaaaaggatcgcgtgatggcgcaattcgcggccggcgaa
atcaatctgctggtcgcgacaaccgtcgtcgaggtcggcgtcgacgttccggcggcgacg
atcatggtgatcgagaacgccgaacgcttcggtctggcgcaactccatcagttacgaggc
cggatcggtcgtggttcggagccctccacgtgcctgctgctttaccgggagcctttgggc
gagatgtcagccgcccggctgcgggtgatccgggagaccacggacggattccgcattgcc
gaagaagacctgaggctgcgcggcgaaggcgatgtgctcggcacgcgtcaaagcggcctg
cccggctatcgcgtcgcgcgctcggatgtccatgcgcaactcatcacgctggcccgcgac
gaagccctgcgcattctgaagcagaatccgaatctcacgggctcgcacggcgaagccttg
cgatgcctgctgtatctgtttgagcgcgacgaagccctgcccctgctcggcgcgggttaa

DBGET integrated database retrieval system