KEGG   Nitrobacter winogradskyi: Nwi_1522Help
Entry
Nwi_1522          CDS       T00276                                 

Definition
(GenBank) Acriflavin resistance protein
  KO
K07788  multidrug efflux pump
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Nwi_1522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwi02000]
    Nwi_1522
Transporters [BR:nwi02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Nwi_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL
Motif
Other DBs
NCBI-ProteinID: ABA04783
UniProt: Q3SSF8
Position
complement(1657863..1660985)
Genome map
AA seq 1040 aa AA seqDB search
MGVSEPFIRRPIATSLLGIALMIGGALGYWALPVSALPQVDFPTVQVRTQLPGASPDVVA
SLLTAPLERQLGQIPSLSSMTSTSSYGLSQISLQFNLDRDIDGATQDVQAAINAAAGILP
RNLPYPPTYAKVNPADAPVMTLALTSDTVSMRAMSDIADTILTQRLSQISGVGRVSVLGG
LKPAVRVQADLTRLAAYGISMEDLRTAIASANVSGPKGSLDGAQQAYTIAANDQVTTADA
YRPIIIAYRNGSPVTIGDVARIVDGLENNRTGGWYNGTPAVIIDIQRQPGANVIEVVRQI
REEIPKLQSAIPAGVDLTVVSDRTVTIRASVHDVQFTLILSIVLVTLVVLLFLRSLRATL
IAGVALPLSLITSFGIMYFAGFSLDNLSLMALTIGTGFVVDDAIVMIENIVRHIENGESV
MEAALRGAREIAFTVISLTVSLIAVFIPLLFMSGLVGRMFREFALTLTIAVVTSAVVSLT
LTPMMCSRLLKRSEGGVSIPGVAAVNRSIDRLVAFYHLTLLWVLRHQQATLGVVLATIVA
TMLLYVVAPKGFLPLQDTASVIAVTEAGPDVSFAEMQRRQAEVAAVIKADPDVTGVVSVI
GAASVNPTTNAGRLVMTLSPRNDRRDDVAAVIARLKARVASIPGMTVYFQPVQDIQISTR
TSRSLYQYTLTGTDAAQVSEWTRKLVEELRRDPLFRDVSSEAQDAGLRAALNIDRARAGQ
LGVSLQAVNDTLNDAFAQRQISTVYGQSNQYRVVLEALPQYQRDPSILSKLFLPGVAGAQ
VPLSAVATLTRTTAPLAISHQAQFPASSLSFNLAPGEALGDAVKRVKTIETRIGMPSNIA
GMFSGDAAEFSKSLAGQPWLILAALVTIYIVLGVLYESYIHPITILSTLPSAGIGAILAL
MLFGQDLSVIGLIGIILLMGIVKKNAIMMIDFALEAERRQGMSSTDAIVQACLLRFRPIM
MTTLAALFGALPLAVESGTGSELRFPLGISIIGGLLLSQLLTLYTTPVIYLALDRLNKRI
EQAVPTGGSGPPPGAIEGMK
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtttcggaaccgtttatccgtcgtccgatcgcgacctccttgctcgggatcgcg
ctgatgatcgggggcgcgctcggctattgggcgctgccggtctccgcgctgccgcaggtt
gatttcccgacagtgcaggtgaggactcagctgccgggcgcaagtcccgatgtcgtcgcg
tcattgctgacggcgccgctggaacgtcagctcggacagatcccgtcgctgtcgtcgatg
acgtcgacaagttcgtacgggctcagccagatctccctgcagttcaacctggatcgggat
attgacggcgccacgcaggacgtgcaggcggccatcaatgcggccgcgggaatcctgccg
agaaatctgccgtacccgccaacctacgccaaggtgaatcctgccgacgcgccggtgatg
acgctcgctttgacctcggacacggtctcgatgcgcgccatgagcgatatcgcggatacc
attctcacccagcgcctcagtcagatttcgggcgtcggccgcgtttccgtgctcggaggc
ttgaagccggcggtgcgcgtccaggccgatctcacgcggctggccgcctatggcatttca
atggaggatttgcggaccgcgatcgccagcgccaacgtttccggccccaagggatccctg
gacggcgcgcagcaagcctatacgatcgcggcgaacgaccaggtcacgacggccgacgca
taccgacccatcattatcgcttaccgtaacggttctccggtcacgatcggcgatgtcgcc
cggatcgtcgacggactggagaacaaccgcactggcggctggtacaacggaacgccggcg
gtcatcatcgatatccagcgccagcccggcgccaatgtgattgaggttgtccggcagatc
cgggaggagattccgaaactccaaagcgcgattccggccggtgtcgacctgaccgtcgtc
agcgaccggaccgtgacgatccgcgcatccgtccacgacgtgcagttcaccctcattctc
agcatcgtcctcgtgacgcttgtcgtgctgcttttcctgcgctcgctgcgggcgacattg
atcgcgggggtggcgctgccgctatcgctgatcaccagtttcggcatcatgtatttcgca
ggcttcagcctcgacaacctgtcgctgatggcgctgacgatcggcaccggattcgtggtc
gatgacgccatcgtcatgatcgaaaacatcgtccggcacatcgagaacggcgagagcgtc
atggaagccgcgctccggggcgcgcgcgagatcgccttcaccgtgatctcgctgacggtt
tcgctgatcgcggtgttcatcccgctgttgttcatgtccgggctggtcggaagaatgttc
cgcgagttcgccctgacactgacgatcgcggtcgtcacctccgccgtggtgtcgctcacg
ctgacgcctatgatgtgctcgcgtctgctcaagcgctcggaaggaggcgtttcgatcccc
ggagtggcggcggtcaaccgcagtatcgaccggctggtcgcgttctatcatttgacgctg
ttatgggtcctccggcatcagcaggcgacactgggcgttgtccttgcgacgatcgtcgcg
acgatgctgctctatgtcgtcgcgccaaagggcttcctgcccttgcaggacacggcgtcg
gttatcgccgtcaccgaggcggggcccgacgtctccttcgccgaaatgcaaaggcgtcag
gccgaggtagcggccgtcatcaaggcggaccctgacgtcacaggcgtcgtatccgtcatt
ggcgccgcttcggtgaatccgaccacgaatgccggccgtctggtgatgacgctgagtccg
cgcaacgaccgccgtgacgacgtcgctgccgtcatcgcgcgcctcaaggcgcgcgtggct
tcgattcccggcatgacggtttattttcagccggtgcaggacattcagatcagcacgcga
accagccgttcactgtatcaatacaccctgacggggacggacgcggcccaggtttcggag
tggacccgcaagctggtcgaggaactgcgccgcgatccgcttttccgggacgtatcgtcg
gaagcgcaggacgcaggtcttcgcgccgcgctgaacatcgaccgcgctcgcgcgggccag
ttgggcgtcagccttcaggcggtcaacgacacgttgaacgatgcctttgcccagcggcag
atatcgacggtttatggacagtccaatcagtatcgcgtcgtgctggaggctctgccgcag
tatcagcgcgacccctcgatcctctccaagctctttctgccgggggtggccggggcccag
gtgccgctatccgccgtcgcgacgctgacccgaacaaccgcgccgctggcgatctctcat
caggcgcagttcccggcatcctcgctcagcttcaacctcgctccgggagaggcgctgggc
gacgccgtgaaacgggtcaagaccattgagacccgcatcggcatgccctccaatatcgcc
ggcatgttttcgggtgacgcggccgagttctcgaaatcgcttgccggtcagccctggctg
atcctggccgcgctggtcacgatctacatcgtgctgggcgtcctgtacgaaagctatatt
catccgattacgatcctctcgacactgccttcggcgggtatcggcgccattctcgccttg
atgctgttcggacaggatctgtcggtgatcggcctgatcggcatcattcttctgatgggc
atcgtgaagaagaacgcgatcatgatgatcgatttcgcgctggaggctgaacgccgtcag
ggcatgtcttcgacggatgcgatcgtgcaggcgtgtttgctccgcttccgacccatcatg
atgacgacgctggcggcgctgttcggcgcgctgccgctggcggttgaaagcggcaccggc
tcggagttgcggtttcctctcggtatttcgatcattggcggtttgctgctcagtcagctg
ctcacgctttacaccacgcccgtgatctatctggcgctcgaccggctgaacaagcgcatc
gagcaagccgttccgaccggcggttcggggccgccgccaggcgcgatcgaaggcatgaaa
taa

DBGET integrated database retrieval system