KEGG   Nitrobacter winogradskyi: Nwi_1525Help
Entry
Nwi_1525          CDS       T00276                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent enzyme, beta subunit
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00270  Cysteine and methionine metabolism
nwi00920  Sulfur metabolism
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01130  Biosynthesis of antibiotics
nwi01200  Carbon metabolism
nwi01230  Biosynthesis of amino acids
Module
nwi_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Nwi_1525
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Nwi_1525
Enzymes [BR:nwi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Nwi_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABA04786
UniProt: Q3SSF5
Position
1664324..1665382
Genome map
AA seq 352 aa AA seqDB search
MRILHLMRIDNDVVEAIGNTPLIKLKRASEATGCTILGKAEFMNPGQSVKDRAGKQMILE
AEKRGDLKPGGLVVEGTAGNTGIGLAIVASARGYRTMIVIPETQSREKKDMLRLCGAELV
EVPALPYSNPNNYQHIARRLADELRESEPNGVLFADQWNNLDNPKAHYVSTGPEIWEQTD
GKVDGFICSIGTGGTLAGVSAFLREKNKDIVIGVADPRGAAMYELFKNGVAKPTAGGSIT
EGIGLGRVTPVIADARVDEAYLVPDEEAVPVIYDLLEHEGLCLGGSTGVNVAGAIRLARQ
LGPGHTVVTILCDSGNRYQSKLFNPDFMRSKNLPVPQWLERRSTVKVPLAEV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttgcatctcatgagaatcgataacgacgtcgtagaagcgatcggcaataca
cctcttatcaagttgaagcgcgcctccgaagcaacaggatgcaccattctcggcaaggcc
gagttcatgaatccgggtcagtccgtcaaggatcgcgccggtaagcagatgatcctggaa
gccgaaaagcgcggcgacctcaagcccggcggcctcgtcgttgaaggcacggccggcaat
accggcatcggtcttgccatcgtcgccagcgctagaggctatcgcacgatgatcgtcatt
ccggaaacacaaagccgtgaaaagaaagacatgcttcggctatgcggcgccgagctggtc
gaggttccggcgctcccctacagcaacccgaacaattatcagcacatcgcaaggcgtctc
gctgacgaattgcgcgaatccgaacccaacggtgtgctgttcgccgaccaatggaataac
ctcgacaatccgaaggcccattacgtttccacgggtccggaaatctgggagcagacggat
ggaaaggtcgatggcttcatctgttcgatcggcaccggcggcacgctcgccggagtgagc
gctttcctgcgggagaaaaataaagatatcgtcatcggcgtcgcggacccgcgcggcgcg
gccatgtatgaactgttcaagaacggcgtggccaagccgaccgcgggaggctcgatcacc
gaggggatcgggctcggacgcgtgacgcccgtgattgccgacgccagggttgacgaagcc
tatctcgtcccggacgaggaggctgtgcccgtgatctacgatctgctcgaacacgagggg
ctttgccttggcggctcgaccggcgtcaacgtcgccggcgcgattcgtctcgcgcgccag
ctggggcccggccataccgtcgtgacgatcctgtgcgactcgggcaaccgctatcagtcg
aaacttttcaacccggacttcatgcgctccaagaaccttcccgtgccgcaatggctcgag
aggcggagcacggtgaaggttccgctcgcagaagtttaa

DBGET integrated database retrieval system