KEGG   Nitrobacter winogradskyi: Nwi_1528Help
Entry
Nwi_1528          CDS       T00276                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 1, PAAT family
  KO
K09970  general L-amino acid transport system permease protein
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi02010  ABC transporters
Module
nwi_M00232  General L-amino acid transport system
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Nwi_1528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwi02000]
    Nwi_1528
Transporters [BR:nwi02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   General L-amino acid transporter [MD:M00232] [OT]
    Nwi_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABA04789
UniProt: Q3SSF2
Position
complement(1667669..1668874)
Genome map
AA seq 401 aa AA seqDB search
MATRSRKPPLQFSLRLRRALGGRAGWSGLALQVLFVAILAWIGYEIVANARGNLEAQNTA
SGLGFMSNTAGFGVSQTLIPYSQTDSYTRVFLVGLVNTLVVAAVGIFFATVIGFMVALGR
LSPNWLISRISGGYVELVRNLPLLFQILFWYLAVLRMLPSPKQSISILDGVFLSNRGLAI
PRPVGQEGLIAFAVAIAVAIIGCMVLRSHSRRSLFRTGRALVVWPYALGLLIFLPAVAIA
VFGIPFTFEMPVLKGFNFSGGARLIPEFVALAIALSTYTAAFIAEVVRAGILSVHKGQME
AGAALGLSRGSTLRLIVVPQAMRVVLPPLTNQYLNLTKNSSLAVAIGYPELFSVFAGTTL
SQTGQAIEILAITMGVYLLISLVTSGIMSIYSRRVARSVRA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccacccggtcccgaaaaccgccgctgcaattttctctcaggctacgacgcgcgctt
ggcgggcgggcgggctggagcggacttgcgttgcaggtgctgttcgtcgcgatccttgcg
tggatcggctatgagatcgtggccaacgccagaggaaacctggaagcgcagaataccgcg
tccgggcttggtttcatgtcgaataccgcggggttcggggtcagccagaccctgatcccg
tattcccagaccgacagctacacgcgtgtttttcttgtcggtctcgtgaatacgctggtg
gtggccgcggtcggcattttcttcgcgacagtgatcggcttcatggtggcgcttggccgc
ttgtcgccgaactggctgatatcccgcatttccggcggctatgtggagctggttcgaaat
ctgcccttattgtttcagattctgttctggtaccttgccgtgctgcggatgctcccgagt
ccaaagcaaagcatctcgatccttgatggcgtctttctcagcaatcgcggtctcgcgatc
ccgaggccggtcgggcaggaggggttgatcgcgttcgccgtcgcgatagcggttgccatc
atcggctgcatggtgctgcggagccattcccgtcgcagcttgtttcggaccggacgagcg
ctggtcgtctggccctatgctcttggtctgctgatctttctgccggccgtagcgatagcc
gttttcggtattcccttcacgttcgaaatgccggtcctcaagggattcaatttctccggc
ggcgcgcgtctgatccccgaatttgtcgcactggcgatcgcgctctcgacgtatacggcc
gccttcatcgcggaagtcgtgcgcgccggaattctctccgtgcacaagggtcagatggaa
gcaggcgccgcgctcgggctttcgcggggatcgacgctgcgattgatcgtggtcccgcaa
gccatgagggtcgtcctgccgccgctgaccaatcagtatctcaacctcaccaagaattct
tcgctggctgtcgccatcggatatccggagttgttctccgtgttcgccgggacgacgctc
agccagaccggacaagccatcgagatcctcgcgatcacgatgggcgtgtatctgctgatc
tcgctggtaaccagcgggatcatgagcatctactcccggcgcgttgcgcggagcgtaagg
gcatga

DBGET integrated database retrieval system