KEGG   Nitrobacter winogradskyi: Nwi_1537Help
Entry
Nwi_1537          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SgrR_N PsbX
Motif
Other DBs
NCBI-ProteinID: ABA04798
UniProt: Q3SSE3
Position
complement(1683509..1684045)
Genome map
AA seq 178 aa AA seqDB search
MRMAVILAALCAVVFVSQADARPKQTTSIMSRSSFAHHPKQLISRRNRRKTGHLITAHRD
TTRPLPPGLHRIMATGAGRIVGGRPRGCPRRYCGCGASLHIFGRIIPRLNLAANWLRFPR
AAPAPGMVAARRGHVFVLKRHIRGKVWLVWDANSGRGKTRVHPRSIAGFTIVDPRAGA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatggcggtcattctggcggcgctttgcgctgtcgtgttcgtatcgcaggccgat
gcgaggccgaagcagacgacctcgataatgtcgaggtcgtcctttgcgcaccaccccaag
caattgatatcacgtaggaataggcgaaaaacgggccatttgatcaccgcccatcgggat
accactcgtcccctccctcccggccttcaccgcatcatggcgaccggagcgggacgcatc
gtcggaggccgcccacgcggctgcccgcgccgctactgcggctgcggggcttcgctccat
atcttcggtcggatcatcccgaggctgaacctggcggcgaactggctgcgctttcctcga
gcggccccggcgcccggcatggtcgcagcgcgtcgaggccatgtgttcgtgctcaagagg
catatcagggggaaggtatggctggtttgggatgccaactccggccgaggcaagaccaga
gttcatccgcgttcgatcgcggggttcacgattgtcgatccgagggcaggggcgtga

DBGET integrated database retrieval system