KEGG   Nitrobacter winogradskyi: Nwi_1540Help
Entry
Nwi_1540          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M15_4 Extensin-like_C LapA_dom UCR_6-4kD Wzy_C
Motif
Other DBs
NCBI-ProteinID: ABA04801
UniProt: Q3SSE0
Position
complement(1684998..1685771)
Genome map
AA seq 257 aa AA seqDB search
MTKWPRDNQADLLAFYGTPGRDVERQLVDVVPPFQMYYDGKPISRIRFHRKAAGALRAAL
DEIWEHYGRDQRRIDALGISKYAGAYNPRKVRGSATRWSNHAYGAAIDLNAEQNGLGAGR
GTMPQPVINAFKRQGARWGGDYRGRTDPMHFEFCDASGYPGVTPVKLFDAPEIDADSDAH
IEHSAAIDVSPKPTWLRRKWKAVTGWFSGGAGLGFFGYLTDWRVIAVLLGAMVLVAVLFV
LFMGPSNVRAWIKRQVN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtggccgagagacaatcaagccgatctgctggctttttacggcacccctggc
cgcgacgtcgagcgccaactcgtcgatgtcgtgccgcctttccagatgtattacgacggc
aagccgatcagccgtatccggtttcatcggaaggcggccggcgcgctcagggcggcgctg
gatgaaatctgggagcattacggtcgcgaccagcgcaggatcgatgcgctcggcatctcg
aagtacgccggcgcctacaacccccggaaggtgcgtggcagcgccaccaggtggtcgaac
catgcttatggcgccgcgatcgacctcaatgcggagcaaaatggactcggggccggtcgc
gggacgatgccgcagccggtcatcaatgccttcaagcgtcagggcgcgcgatggggcggc
gactatcgtggccgcaccgatcccatgcatttcgagttctgcgacgccagcgggtatccg
ggggtaacccctgtcaaactcttcgatgctccggagatcgacgcggatagtgatgctcac
attgagcattctgccgccatcgacgtctcgcctaaaccgacgtggttacgccgcaagtgg
aaagccgtcacaggctggttttccggcggcgctggacttggtttcttcggctacctgacc
gactggcgagtaatcgcggtgctgctcggcgccatggtgctggttgccgtgttgttcgtc
ctgttcatggggccgagcaacgtgcgcgcgtggatcaagcgacaggtgaactga

DBGET integrated database retrieval system