KEGG   Nitrobacter winogradskyi: Nwi_1541Help
Entry
Nwi_1541          CDS       T00276                                 

Definition
(GenBank) helix-turn-helix, Fis-type
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve HTH_32 rve_3 HTH_28 HTH_23 HTH_29 LZ_Tnp_IS481 HTH_Tnp_1 DDE_Tnp_IS240 DUF1153
Motif
Other DBs
NCBI-ProteinID: ABA04802
UniProt: Q3SSD9
Position
1686140..1687627
Genome map
AA seq 495 aa AA seqDB search
MQGRDIRRRYFSKNFRVCPPSGLLRQFRSFREGRISGSSQPIWSADETEIRTRQSAGRTG
AEGHPTADAPALFGGGEDPYRAGRTARRGEHLRALPPRRHRRLDVLRLVQGVPGSRQAPV
GGRHGTCRNLWRGERSSSGSLGVEGSRRRSHPGEPSAKKKHERGWGERGMRYPASEKAEI
IALVEQSHLPAKRTLDKLGIPRATFYRWYDRYRAGGIEALADHRSRPDRVWNRIPDDVRG
QIIDLALELPELSPRELAVRFTDERKYFVSEASVYRLLKAHDLITSPAYVVIKAANEFKD
KTTAANQLWQTDFTYLKITGWGWYYLSTVLDDFSRYIVAWRLGPTMCASDVTATLDQALA
ASGLDHVSVRQRPRLLSDNGSSYVADDLATWLRAKDMQHVRGAPYHPQTQGKIERWHQTL
KNRILLENYYLPDDLKRQVAAFVEHYNHDRYHESIGNVTPADVYFGRAETILAERHRIKR
DTIANRRLQHQLQAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggcgtgacattcggcggcgttacttttcaaagaacttcagggtctgtccgccg
tcagggctcttgagacagtttaggagttttcgggaagggaggatttctggatcatcgcag
ccaatttggagcgcagatgagacagaaatccggaccaggcaaagcgccggcagaacaggt
gctgaaggacatccgacggcagacgcgccggcattattcggcggaggagaagatccgtat
cgtgctggaaggactgcgcggcgaggagaacatctccgagctttgccgccgcgaaggcat
cgccgcctcgatgtattacggttggtccaaggagttcctggaagccggcaagcgccggtt
ggcgggcgacacggcacgtgccgcaacctctggcgaggtgaaagatcttcgtcgggaagc
ctcggcgttgaaggaagtcgtcgccgatctcaccctggagaaccgtctgctaaaaaaaag
catgaacggggatggggagaacgaggcatgaggtatcctgcgtccgagaaagccgagatc
atcgcgttggtggagcagtcgcatttgccggccaaacgcacgctggacaagctcggcatc
ccccgcgccacgttttatagatggtacgatcgctaccgcgcgggcggcattgaggccctg
gcagatcaccgctctcgaccggatcgggtctggaatcgtatcccggatgacgtccgcggc
cagatcatcgacctggcattggagcttccggaactatcgccgcgagagctcgccgtgcgg
tttaccgacgagagaaagtactttgtctcggaggcttcggtctatcggctgctgaaggcg
cacgacctcatcaccagtccggcctatgtagtgatcaaggcggcgaacgagttcaaggac
aagaccaccgccgccaaccagctctggcagaccgacttcacctacctgaagatcaccggc
tggggctggtactatctatcgacggtgctcgacgacttctcgcgctacatcgtcgcctgg
aggttaggtcccacgatgtgtgcctccgacgtcacggctacgctcgatcaggcactggcc
gcctctggtctggatcacgtcagcgtcaggcagcggccccggcttctcagcgacaatggt
tcgagttacgtcgcggatgatctggccacgtggctcagggccaaggacatgcagcatgtg
cgcggagcgccgtatcatcctcagactcagggcaagatcgagcgttggcatcaaacgttg
aagaaccgcatcctgcttgagaactactatttaccggacgacctcaaacgtcaggtcgcc
gcgttcgtcgaacactataatcatgaccgctaccacgagagcatcggcaacgttacacct
gccgacgtctacttcggcagggctgagacaatcctcgccgaacgacaccgcatcaagcgc
gacaccatcgcaaaccgtcgcttgcagcatcagctgcaggccgcttaa

DBGET integrated database retrieval system