KEGG   Nitrobacter winogradskyi: Nwi_1543Help
Entry
Nwi_1543          CDS       T00276                                 

Definition
(GenBank) peptidase S14, ClpP
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CLP_protease SDH_sah
Motif
Other DBs
NCBI-ProteinID: ABA04804
UniProt: Q3SSD7
Position
complement(1688930..1689775)
Genome map
AA seq 281 aa AA seqDB search
MSLRKLPEARTFQRPQNFQWDAPSDVLARWSETPRAAASDDDATISMYEVIGEDWWSGGG
VTAKRISAALRSIGDRDVTVKINSPGGDMFEGIAIYNLLRGHPARVTVEVLGWAASAASI
IAMAGDEIRMGLGTFMMVHNAWGVVIGNRHDMRESAELFDGFDSAIVDIYEARTGLKRSA
IEKLMDAETFMGPSEAVKNGFADLVDDAIGADQSEAENSVAGAVNARRRMDAALAKQGVP
RVERRRMFAELAGGTHDAAPTATHDAGLVAAARQFINAIRS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcgcaagctgcctgaggcgcggacgtttcagcgcccgcagaattttcaatgg
gacgcgcccagcgacgttctcgctcgctggtccgagactccgcgtgccgccgcgtccgac
gacgatgccaccatcagcatgtacgaggtgatcggcgaggattggtggtcgggcggcggt
gtgacggccaagcgcatttccgcagcgctgcgctcgatcggagaccgcgacgttaccgtc
aagatcaactcgcccggcggcgacatgttcgaaggcatcgcgatctacaatctgttgcgc
ggccatcctgcgagggtgacggtcgaggtgctgggctgggcggcgtccgccgcctcaatc
atcgccatggccggcgatgagattcgcatgggtctcggcaccttcatgatggtgcataac
gcctggggcgtcgttatcggcaatcgtcacgacatgcgcgaatcggccgagctgtttgac
gggttcgacagcgccattgtggatatctacgaagcgcgcaccggcctgaagcgctccgcg
atcgaaaagctgatggacgccgaaaccttcatggggccgtccgaggctgtcaagaatggc
tttgctgacctggtcgatgacgccatcggcgccgaccagtcggaagccgagaactctgtc
gctggcgcggtgaacgcccggcggcgcatggatgctgctcttgcgaaacagggcgtcccg
cgtgtcgagcggcggcgcatgttcgcagagctcgcagggggcacgcatgacgctgccccg
acagctacgcatgacgctggcttagtcgctgccgcccggcagttcatcaacgcaatccgg
tcatag

DBGET integrated database retrieval system