KEGG   Nitrobacter winogradskyi: Nwi_1547Help
Entry
Nwi_1547          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terminase_4
Motif
Other DBs
NCBI-ProteinID: ABA04808
UniProt: Q3SSD3
Position
complement(1694228..1694698)
Genome map
AA seq 156 aa AA seqDB search
MRGAKPKLRNVIPMRPDDVDAEKLRKKMMQRAIRRLMPRDLPAEVEKEYKRVAAILADPS
VDRLKARYIDTIIEYCRCTVRMRGLRASMPTLAHEIYRVKTRNGDQVKSHPHVAQVNESW
RQWRSLIAMLGLSPTDERNLLPGQGDLFDENDQYFD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgctaaaccaaagctccgaaacgtcatcccgatgcggccggatgacgtcgat
gcggaaaagcttcgcaagaagatgatgcaacgggcgatccgccggctgatgccgcgtgat
ctgccggcggaggtcgagaaggaatacaagcgcgtcgctgcgatccttgcggatccatcg
gtcgaccgtctcaaggcgcgctacatcgacacgattatcgaatactgccgctgcaccgtt
cgaatgcgcggcctgcgggcgtcaatgccgacgctggcgcacgaaatctaccgcgtgaaa
acgcgcaacggcgatcaggtgaaaagccacccgcatgttgcgcaggtcaacgagagttgg
cggcagtggcgatcgctcattgcgatgctcggtctgtcgccgaccgatgagcgcaacctt
ctgcccggtcagggcgacctgttcgatgaaaatgaccaatacttcgactaa

DBGET integrated database retrieval system