KEGG   Nitrobacter winogradskyi: Nwi_1548Help
Entry
Nwi_1548          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH
Motif
Other DBs
NCBI-ProteinID: ABA04809
UniProt: Q3SSD2
Position
complement(1694944..1695330)
Genome map
AA seq 128 aa AA seqDB search
MSMPTVSDYDARRGSARSRGYDGRWDRAAKQFKWKHPLCLGCKAEGRVTPTAVVDHVVPH
RGDMVLFWDQDRWQSSCDFHHNVVKQQLEHMFDRGALPEAELWLDSATAVAISRRERAVI
GVDGWVGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
ttgagtatgccgaccgtttccgactacgatgcgcgccgtggttctgctcgctctcgtggt
tacgatgggcgctgggatcgtgcagcgaagcagttcaagtggaaacatccgctttgcctc
ggttgcaaagcagagggcagggtaacgccaacggcagtggtcgatcacgtcgtcccgcac
cgaggcgacatggtgctgttctgggatcaggacaggtggcaatcgtcctgcgatttccac
cacaacgtggtcaagcagcagctcgagcacatgttcgatcgcggcgcgcttccggaggcc
gagctgtggttggactcggcgacagcggtcgcgatcagccgtcgcgagcgagcggtgatc
ggtgtcgatggttgggttggaggctga

DBGET integrated database retrieval system