KEGG   Nitrobacter winogradskyi: Nwi_1557Help
Entry
Nwi_1557          CDS       T00276                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2312 DUF1378
Motif
Other DBs
NCBI-ProteinID: ABA04818
UniProt: Q3SSC3
Position
complement(1702512..1703132)
Genome map
AA seq 206 aa AA seqDB search
MTTARAEARSRLKDFIERIERIAADRRDLGDDMKAVFAEAKAEGFDTKAMRRIIKRRDKD
PAEVAEEDSIFETYMAELGMTPEAPLPSMVRALGVDVLAREQVIDVLSSLIPNNGEIIAR
VGGDPMRLWRDEEGRAYAEVYVPPAAAPKEKTGRALKTPATVLTMVPGGKLATSDDVRRK
ADAAEKRSKVSKPDEDPDSDDEGEDA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcccgcgccgaggcgcgttcgcgcctgaaggatttcattgagcgcatcgag
cggatcgcggccgatcggcgcgatctcggcgacgacatgaaggctgtattcgccgaggcc
aaggccgaaggcttcgacaccaaggcgatgcggcgcatcatcaagcggcgcgacaaagac
ccggccgaggtggccgaggaagattccattttcgagacctacatggcggaactcggcatg
acgcccgaggcgccgttgccgtccatggttcgcgcgctcggcgtcgacgtgctggcgcgc
gagcaggttatcgacgtgctgtcgtcactcattccgaacaatggcgagatcatcgcccgc
gtcggcggtgatccgatgcggttgtggcgcgacgaagagggccgggcctatgccgaggtt
tatgtgccgccggcggctgcaccgaaggaaaagaccggccgcgcgctgaaaacgccggcg
accgtactcaccatggtgccgggcggaaagcttgcaaccagcgacgacgtcaggcgcaag
gccgacgcggcggagaagcgcagcaaggtgagcaagcccgacgaggatcctgacagcgac
gacgaaggcgaggacgcatga

DBGET integrated database retrieval system