KEGG   Nitrobacter winogradskyi: Nwi_1559Help
Entry
Nwi_1559          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA04820
UniProt: Q3SSC1
Position
complement(1703752..1704144)
Genome map
AA seq 130 aa AA seqDB search
MTRPSPTGAKLSKTGADHSIGKYRSIDRWFSRVVDALRREHPDKLAQTLADYAHRPQRVC
ELWLAGRQSPNGEALASLLRSPIGGIVLDAITAGAEAEWIARDRRARRLLTIHEREAELR
REKAQALEDV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaccgagcccgaccggcgcaaaactgtcaaaaaccggcgccgatcattcgatc
ggtaaataccgatcaatcgatcggtggttttcgcgggtggtcgacgcgcttcgccgtgaa
catcccgacaagctagcgcaaacgctggcggattacgcgcatcggccgcagcgcgtctgt
gaattgtggctcgccggacggcaatcgccgaacggcgaggcgctggcctcgctgctccgc
agcccgattggcggcatcgttctcgatgcgatcaccgccggcgctgaagccgagtggatc
gcgcgcgaccgcagggcgcggcggcttctcaccattcatgagcgcgaggccgagcttcgc
cgggaaaaagcgcaagccctggaggatgtctga

DBGET integrated database retrieval system