KEGG   Nitrobacter winogradskyi: Nwi_1568Help
Entry
Nwi_1568          CDS       T00276                                 

Definition
(GenBank) Excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    Nwi_1568
DNA repair and recombination proteins [BR:nwi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Nwi_1568
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Nwi_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_29 AAA_21 AAA_16 RsgA_GTPase DnaJ_CXXCXGXG AAA_25 AAA_23 BCA_ABC_TP_C APS_kinase AAA_33
Motif
Other DBs
NCBI-ProteinID: ABA04829
UniProt: Q3SSB2
Position
1711725..1714706
Genome map
AA seq 993 aa AA seqDB search
MDEVIKAKRQQSSPASRAITIRGAREHNLKNVDLEIPRDKLVVFTGLSGSGKSSLAFDTI
YAEGQRRYVESLSAYARQFLEMMQKPDVDQIDGLSPAISIEQKTTSKNPRSTVGTVTEIY
DYMRLLWARVGVPYSPATGLPIESQTVSQMVDRVLALPDGTRLYLLAPVVRGRKGEYRKE
LAEYLKKGFQRVKIDGSFHELADAPALDKKFPHDIDVVVDRIVVRPDLGQRLAESFETAL
KLAEGLAVIEYADAPPPLPHGAGDKKKVAKIHDRSGPERILFSEKFACPVSGFTLPEIEP
RLFSFNNPYGACPKCGGLGVEQHVDENLVIPNRELTLRKGAIAPWAKSSSPYYLQTLTAL
GKFYKFALDTRWKDLPKKTQAALLHGSGDNEIRFSYEDGVRSYETRKPFEGVIPNIERRY
RETESEWAREELGKYFSDVPCDSCKGYRLKPEALCVKIGGKHIGEISELSVRGAGEWFET
VPTMLSAQQNEIAGRVLKEIRERLSFLLDVGLGYLTLSRASGTLSGGESQRIRLASQIGS
GLTGVLYVLDEPSIGLHQRDNARLLETLKRLRNLGNTVIVVEHDEDAIRLADHVLDIGPG
AGVHGGHIVAQGTPADIMRNPRSLTGKYLTGELSVEIPERRPPNHRRTIKLVNARGNNLK
NVTAEIPLGLFTCITGVSGGGKSTLLIDTLYKAIARKLNNASDPPAPHDRIEGLEHIDKI
IDIDQSPIGRTPRSNPATYTGAFTPIREWFAGLPEAKARGYAPGRFSFNVKGGRCEACQG
DGVIKIEMHFLPDVYVTCDACKGKRYNRETLEVLFKGKSISDVLDMTVEEAAEFFKAVPR
VRDTFLTLQRVGLGYIRVGQQATTLSGGEAQRVKLAKELSKRATGRTLYILDEPTTGLHF
HDVKKLLEVLHELVAQGNTVAVIEHNLEVIKTADWVIDLGPDGGDGGGEIVAWGAPEDIV
KAPRSHTGKFLKPILEKAGKPRRHNPNASEAAE
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagtcataaaggccaagcggcaacaatcgagccccgcgagtcgcgccatcacg
atccgcggcgcgcgcgaacacaatctgaagaacgtcgatctggagatcccgcgcgataag
ctggtggtgttcaccggcctttccggctccggcaagtcctcgctggcgttcgacaccatc
tatgccgaaggccagcggcgctatgtcgagtcgctgtcggcttacgcgcgtcagttcctg
gagatgatgcagaagcccgatgtcgatcagatcgacgggctgtcgcctgcgatatccatc
gaacaaaagacgacgtcgaagaacccgcgctccaccgtgggaaccgtgacggaaatctac
gattacatgcggttattatgggcgcgcgtcggcgtgccctattcgcccgccaccggcctg
ccgatcgagagccagacggtgtcgcagatggttgatcgggttttggcgctgcctgatggc
acgcggctctatctgctggcgccggtcgttcgcggccgaaagggcgaatatcgaaaagaa
ctggcggagtatctcaagaagggctttcagcgcgtcaagatcgatggctcgttccacgag
ctcgccgacgctcccgcgctggataagaagtttccgcacgatattgacgtggtggtcgat
cgcatcgtcgtccggccggacctaggccagcggctggctgagtcgttcgagacggccttg
aagctcgcggaagggctggcggtgatcgaatatgcggatgcccctcctccgctcccccac
ggcgcgggcgacaagaagaaggtcgcgaagattcacgacaggagcgggcctgaacgcatc
ctgttctcggaaaagttcgcgtgccccgtgtccggcttcacgcttcccgagatcgagccg
cggctgttttcgttcaataatccctacggcgcttgcccgaagtgcggcggtcttggtgtc
gagcagcatgtcgatgaaaatctggtcatccccaacagggaattgacactgcgcaaaggc
gcgatcgcaccgtgggcgaaatcgtcgtcgccgtactacctgcagacgctcaccgcgctc
ggaaaattctacaagttcgctctcgacaccagatggaaggatctgccgaagaagacgcag
gccgcgcttttgcatggctcgggcgacaacgagatcaggttctcctatgaggacggcgtg
cgctcctatgaaaccaggaagccgttcgaaggcgtgatccccaacatcgagcgccgttat
cgcgagaccgaaagcgaatgggcgcgcgaggagctcgggaagtatttctccgatgtgccg
tgcgattcctgcaagggctatcgactcaagccggaggcgctctgcgtcaagatcgggggc
aagcacatcggcgagatcagcgaactgtcggttcgcggcgccggcgaatggttcgagacg
gtcccgacaatgctctcggcgcagcagaacgaaattgccggtcgcgtcctcaaggagatc
cgcgaacggctgtcgtttctgctcgacgtcggccttggctatctcacgctgtcgcgcgct
tccggcacgctgtccggcggcgagagccagcgcattcgacttgcttcgcagatcggctca
ggcctcaccggcgtgctttatgtactggacgagccgtcgatcggactgcaccagcgcgac
aatgcccgcctgcttgaaaccctgaagcggctgcgcaatctcggcaataccgtgatcgtt
gtcgagcacgacgaggatgccatccgcctcgccgaccatgtgctcgatatcggccccggc
gccggtgttcacggcggccacatcgtcgcgcagggcacgccggccgacatcatgcgcaat
cccagatcgctgaccggcaaatatctgacaggcgagctgtcggtcgagatacccgagcgg
cggccgccgaaccatcgccgcaccatcaagctggtcaacgcgcgcggcaacaatctgaag
aacgttaccgcggaaattccgctcggcctgttcacctgcatcaccggcgtctccggcggc
ggcaagtcaacgctgctgatcgacacgctttacaaagcgatcgcgcggaagctgaacaat
gcgagcgatccccccgcgccccatgaccgtatcgaaggcctggagcatatcgacaagatc
atcgacatcgaccagtctccgatcgggcgcacgccgcgctccaatcccgcgacctacacc
ggcgcctttacgccgatccgcgagtggttcgccgggttgccggaagccaaggcccgcggt
tatgcgcccggccgcttctcgttcaacgtcaagggcgggcgttgcgaggcctgccagggc
gatggggtcatcaagatcgagatgcacttcctgcccgatgtttatgtcacctgcgacgcc
tgcaagggcaagcgctacaatcgcgaaacgcttgaggtgctgttcaaaggcaagtcgatt
tcggacgtgctcgacatgacggtcgaggaagccgccgagtttttcaaggcggtgccgcgc
gtgcgcgacaccttcttgacgctgcagcgcgtcggcctcggctacatccgtgtgggacag
caggcgaccacgctgtcaggcggtgaagcgcagcgcgtcaagctcgccaaggaactgtcg
aagcgagcgaccggccgcacgctttacattctcgatgaaccgacaaccggcctgcatttc
catgacgtcaagaaacttcttgaagtgctgcacgaactggtggcgcaagggaacacggtt
gcggtgatcgagcacaatctcgaagtcatcaagaccgcggattgggtgatcgatctcggc
cccgatggcggcgacggaggcggcgagattgttgcctggggagccccggaagacattgtg
aaagcgccgcgcagccataccggaaagttcttaaagccgattctggaaaaggcaggaaag
ccaaggcggcataacccgaatgcgagtgaagcggccgaatga

DBGET integrated database retrieval system