KEGG   Nitrobacter winogradskyi: Nwi_1570Help
Entry
Nwi_1570          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA04831
UniProt: Q3SSB0
Position
1715982..1716251
Genome map
AA seq 89 aa AA seqDB search
MKKTRPIKIIEPASDFIRSGKALKIKIGLLHPPVEAADGGMMSASEPWHQEPWHQERWAS
GARKAGSKLAQMGMRGVESKTASRLKVRK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaacgcgtccaatcaaaatcatagagcccgcttctgattttatcagaagtgga
aaggctctgaagatcaagatcgggctactccatccgccggtagaggcagcggatggtgga
atgatgtctgcctccgagccttggcatcaggagccttggcatcaggagcgttgggcgtca
ggagcacgaaaagccggatcgaaactggctcaaatggggatgcgaggcgttgagtccaag
accgcctcgaggctgaaggttcggaagtga

DBGET integrated database retrieval system