KEGG   Nitrobacter winogradskyi: Nwi_1592Help
Entry
Nwi_1592          CDS       T00276                                 

Definition
(GenBank) transposase, IS4 family
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1_2 DDE_Tnp_1 DDE_Tnp_1_3 DDE_Tnp_4
Motif
Other DBs
NCBI-ProteinID: ABA04853
UniProt: Q3ST48
Position
1740195..1740563
Genome map
AA seq 122 aa AA seqDB search
MLADALGRPLRFIVTAGQVGDITQAPALLEAQAGDAVLADKAYDSNALRALIAGMGAEAV
IPSNRTRKIIIPHDAGLYKHRNRIERCFNRLKHFRRFATRYDRRTVHFTGFVHLAAALIW
LP
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgatgcgctgggccgacccttgcgtttcatcgtcaccgccgggcaggtcgga
gacatcacacaagcccccgcgctgctcgaagcccaggccggggacgccgtgctggccgac
aaggcttatgacagcaacgccttgcgtgcactcatcgccggcatgggcgccgaagcggtg
atcccctcaaacaggacgcgcaaaatcatcatcccgcatgacgccggtctctacaagcac
cgcaaccgcatcgagcgctgcttcaaccgtctcaagcacttccgccgtttcgccacccgc
tacgacaggcgaaccgttcacttcacgggcttcgttcacctggccgcagccctgatctgg
ctgccgtga

DBGET integrated database retrieval system