KEGG   Nitrobacter winogradskyi: Nwi_1596Help
Entry
Nwi_1596          CDS       T00276                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00564  Glycerophospholipid metabolism
nwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nwi_1596
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Nwi_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF4271 MWFE
Motif
Other DBs
NCBI-ProteinID: ABA04857
UniProt: Q3SS84
Position
complement(1745269..1745811)
Genome map
AA seq 180 aa AA seqDB search
MSIPNIITLGRILLVPIIIWAIASNQMEIAFAIFVIAGVSDAVDGFLAKRFNMASELGAL
LDPLADKALLVSIFVTLGIWGAVPIWLVILVVSRDIMIVGAVIVSWLFNKPVPMKPLLVS
KLNTGAQVAFAALVLAALGFGFDSSPYEALLMAAIAILTLVSVSFYLVEWVRHMSTIDPQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccaaatattattacgctcggccgtattctgctcgtgccaatcattatctgg
gctatcgcctccaatcagatggagatcgctttcgccatctttgtgattgccggcgtcagc
gatgcggtggacgggtttctggccaagcgcttcaacatggcgagcgaacttggtgcgctt
ctggatccgctggccgacaaggcgctgctggtctcgatcttcgtcacgctcggcatttgg
ggcgccgtgcccatctggctcgttatcctggtggtctcgcgcgacatcatgatcgtcggg
gcggtgatcgtatcgtggctgttcaacaagccggtgcccatgaagccactgctggtctct
aagctcaatacgggagcgcaggtcgcgttcgcggcgctggtgctggccgcgctgggattc
ggatttgattcctcgccctacgaagcccttctgatggccgccatagcgatcctgaccctg
gtttccgtttctttctatctcgtggagtgggtgcgccacatgagcaccatcgatccgcaa
tga

DBGET integrated database retrieval system