KEGG   Nitrobacter winogradskyi: Nwi_1598Help
Entry
Nwi_1598          CDS       T00276                                 

Definition
(GenBank) formyltetrahydrofolate-dependent phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00230  Purine metabolism
nwi00670  One carbon pool by folate
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01130  Biosynthesis of antibiotics
Module
nwi_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Nwi_1598
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Nwi_1598
Enzymes [BR:nwi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Nwi_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ABA04859
UniProt: Q3SS82
Position
1747145..1747798
Genome map
AA seq 217 aa AA seqDB search
MKRRVAILISGRGSNMTALVEAAKAEDFPAEIAVVISNKPGAAGLARAQAAGVETLVIES
KPFGKDRAAFEAELQSALDDRRIEFICLGGFMRLFTAEFVRGWHGRMLNIHPSLLPSFRG
LDPHGQALRAGVKISGATVHFVVAETDAGPIVMQGAVAVRDDDTAETLAARVLDIEHRIY
PDALRLVAGGGTRLDGDICKTSANASPDDSLISPSVI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccgtgtcgccatcctgatctccggacgcggatcgaacatgacggcgctggtg
gaggctgcaaaggccgaggactttccggctgaaatagccgtcgtcatttccaataaaccc
ggcgcggcgggcctcgccagagcccaggcggccggcgtcgagacgctcgtcattgaaagc
aagccatttggcaaggaccgtgcggcgttcgaggccgaactgcaatccgctctggatgac
aggcgcatcgaattcatctgcctcggcggcttcatgcggctgttcacagccgagttcgtc
cgaggctggcatggacggatgctcaacatccacccctcgctgcttccatcattccggggc
ctcgacccccacggtcaggccctgcgcgcgggcgtgaagatctcaggcgccacggtgcat
ttcgtcgtcgcggaaacagatgccggccccattgtcatgcagggcgcagtggctgtgcgt
gacgacgacacggcggagacgctggccgcgcgcgtcctggacatcgagcatcgcatctac
cccgatgcgctgcggctggtcgcgggcggcggcacgcgactggatggcgacatttgcaag
acgtcggcaaacgccagtccggacgatagcctgatctcgccgtccgtaatctga

DBGET integrated database retrieval system