KEGG   Nitrobacter winogradskyi: Nwi_1603Help
Entry
Nwi_1603          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA04864
UniProt: Q3SS77
Position
1750536..1750742
Genome map
AA seq 68 aa AA seqDB search
MAPTAAFAGKGWHHHGHHHHHGHGHHHHGWRHYAWGPGHFIGGGGGCYVRRLVPTSFGPR
WRVVNRCF
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcccaccgcggcgttcgctggcaagggctggcatcaccacggtcatcatcaccat
cacgggcatgggcatcaccatcacggctggcgccattatgcctggggtcccggccacttc
atcggcgggggtggcggctgctatgtgcgcaggctggtgccgacctctttcggaccgcgc
tggcgcgtcgtcaatcgctgcttctga

DBGET integrated database retrieval system