KEGG   Nitrobacter winogradskyi: Nwi_1607Help
Entry
Nwi_1607          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA04868
UniProt: Q3SS73
Position
complement(1755207..1755557)
Genome map
AA seq 116 aa AA seqDB search
MSSWTLGARKPPQGDGLEIDIAIDGGDPLTLNTLEAETLETGLGKALAGVDNASGRISCV
NAATQIIVAVDKVTVASLRYEKAERLRGHLKELLAGRGTEFADSGAVEDQPHPSVP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttggacgcttggcgctcgtaagccgccccagggggacggcctcgagattgat
attgcgattgatggcggtgatccgctcacgctgaacacgcttgaagccgagacgctggaa
accggactgggcaaagcgctcgcgggcgttgataacgcatccggccggatttcatgcgtg
aatgcagccacccagatcattgtcgccgtcgacaaggtcaccgtcgcttcgctgcggtat
gaaaaggcggagcggttgcgcggccatctgaaagaacttctggccggcagaggtactgaa
tttgccgattcaggcgcggtagaggatcaaccacacccttccgttccctga

DBGET integrated database retrieval system