KEGG   Nitrobacter winogradskyi: Nwi_1609Help
Entry
Nwi_1609          CDS       T00276                                 

Definition
(GenBank) cold-shock DNA-binding protein family
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
nwi  Nitrobacter winogradskyi
Brite
Transcription factors [BR:nwi03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Nwi_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB Rho_RNA_bind
Motif
Other DBs
NCBI-ProteinID: ABA04870
UniProt: Q3SS71
Position
complement(1756446..1757099)
Genome map
AA seq 217 aa AA seqDB search
MGSDGFESRKFAGPAVSDPLGSKEFSGTNDREAGAGPFAGLGESPANIVEISGVIKWFDA
SKGYGFIVPDNGWPDVLLHVTVLRRDGYQTAYEGARLVCDCVQRAKGYQAFRITSMDEST
AIHPAQMLPPRTHVSVTPTSGLERAQVKWFNRLRGFGFLTRGEGTPDIFVHMETLRRFGI
TELRPGQFVLVRFGPGSKGMMAAEVQPETGAPSVSSH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggacggttttgaatccaggaagtttgcggggccggcggtgagcgatcccttg
ggatccaaggaattttccggaacgaacgatcgagaggcgggagccggtccgtttgccggg
ctaggggaatctcccgccaacatcgtcgagatcagcggcgtcatcaaatggttcgacgct
tcaaaaggctacggatttatcgtccccgataatggctggccggatgtgctcctgcacgtc
acggtgcttcgtcgcgacggctatcagaccgcttatgagggagcccgcctggtctgtgac
tgcgtgcagcgggcgaaaggctatcaggcgttccggatcacgtcgatggacgagtccacc
gcgattcatcccgcgcagatgctgccaccccggacacatgtcagcgtaacacccaccagc
ggcctggagagggcgcaggtcaaatggttcaatcgattgcggggatttggcttcttgacg
cgcggcgagggaactccggatattttcgtgcacatggaaacgctacggcgcttcggcatc
acggaacttcggccggggcagttcgtcctggtccgcttcgggccgggtagcaagggcatg
atggccgcggaagtccaacctgaaacgggtgcccccagcgtgtcctcgcactga

DBGET integrated database retrieval system