KEGG   Nitrobacter winogradskyi: Nwi_1616Help
Entry
Nwi_1616          CDS       T00276                                 

Definition
(GenBank) phage Terminase
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terminase_1
Motif
Other DBs
NCBI-ProteinID: ABA04877
UniProt: Q3SS64
Position
complement(1763947..1765560)
Genome map
AA seq 537 aa AA seqDB search
MLAPAWINDGSDIPDPFGYGERAVQWLRRLKHPKNPARGHPFQVDPWQERIIRKLYGPRH
EDGRRVVRRLVLLLPRGNRKTSLCGAITLLHLIGPEKLPGNLVVSAASAHEQAMELFNEV
AMIVQHDRRLEKHLAVREYTSSITFKAQRSRYIAVASDGKVQHGKTPNVVIADELHAWEG
RAGRVQWEALDSALVKVPDTLMIVATTSGRGQENLAWKTIDYAIKVQKGEIDDPATLPVV
FMAEEGDDWRDEAVWHALNPGMRHGYPDLTSYRDKAQKAINSPSDRDSFLQFNLNRWLDH
STSPFVEMLVYDQGARAIDLDELKGEQCWIGVDLSSNSDLTAVVACWRDGDDGYQVQPWF
FCPEDNLRRRADKDGVAYPAWADDGFIIPTPGNVVDFHAVENHIRDLCERFNVREIAFDP
HLARNMLSNLLADGLPAVEMRQGWVTMAPAIKELERAIVGRRFRHGGHPVLRWNFDNIAT
ETDKAGNKSFHKGKSRDRIDGAVATAMAVARCAAGDNARSIYDSPNWSPDWAFVKAG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcctgcatggatcaacgacggcagcgatattcccgatcctttcggttacggc
gagcgcgcggtgcaatggctgcgccggctgaagcatccgaagaatccggcgcgcggtcac
ccgttccaggttgacccgtggcaggaacggatcattcgcaagctctatggtccgcgccat
gaggatggacggcgagtggtgcgccggcttgttctactacttccgcggggaaatcgaaaa
accagcctatgcggcgcaataacgcttttgcatttgattggcccggagaagctgcccggc
aatttggtggtgtcggcggcatccgcgcacgagcaggcgatggagttgtttaacgaggtc
gccatgatcgtccaacacgatcgccggctagaaaagcacttggcggttcgcgaatacacg
tcatcgatcactttcaaggcgcaacgatcgcgctatatcgccgtcgcgagtgacggcaag
gttcagcacggcaagacaccgaacgtcgtcatcgccgacgaattacatgcttgggagggc
agggcaggtcgggtgcaatgggaggcgttggattccgcactggtgaaggtgcctgacacg
ctcatgatcgtggccaccacgtcgggccggggacaagaaaacctcgcctggaaaacgatc
gattacgccatcaaggttcagaagggcgagattgacgacccggccacgttgcctgtcgta
ttcatggcggaagagggcgacgactggcgcgacgaagcggtgtggcacgctctgaacccc
ggtatgcgccatggatatccggacctgaccagctaccgcgacaaggcgcagaaggcgatc
aattcgccgtcagatcgcgacagcttcctgcaattcaatttgaaccgttggcttgaccac
tcgacatcgccgttcgtggaaatgttagtttacgatcagggcgctcgcgcgattgatctc
gatgaactcaagggcgagcaatgctggataggcgtagacctttccagcaactcggatttg
acggccgtcgtggcgtgctggcgagatggcgatgacggataccaggttcagccatggttc
ttctgtccggaagacaatctgcggcgccgcgcggacaaggatggtgtcgcttaccccgct
tgggccgatgacggattcatcattccgacaccgggcaacgtcgtcgattttcacgccgtc
gagaaccacattcgcgacctttgcgagcggttcaacgtccgcgaaatcgcattcgatccg
catctggcgcgcaacatgctcagcaatctactggcggatggccttcctgccgttgagatg
cgtcaaggctgggtgacgatggcgcctgccatcaaagaactggaacgggcgatcgtcggt
cgccgcttccgtcatggcggacaccccgtgctgcgctggaactttgataacatcgccacc
gaaaccgacaaggccggcaacaaatcattccacaagggaaagtctcgcgaccggatcgac
ggcgcggttgcgactgccatggcagttgcacgatgcgcagccggcgacaacgcccgatca
atctacgattcaccgaactggtcgcccgattgggcgtttgtgaaagcaggataa

DBGET integrated database retrieval system