KEGG   Nitrobacter winogradskyi: Nwi_1618Help
Entry
Nwi_1618          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA04879
UniProt: Q3SS62
Position
complement(1765955..1767004)
Genome map
AA seq 349 aa AA seqDB search
MFKLFDRVKVNTPTTGTGDVTFGSVSSNAFVTPAEAGAGDGDTVRYLIVDGTDFEVGIGT
IKSGVTAMERTTVKESKIGGTAGTSKINLSGVAALSLTASAADILVPGNNLADLDDADEA
LDNLGATTVGKALFTAADAENARAALDLSDTLPTTQVFTSGAGTYTTPAGCKWIEVEMIG
GGGGGAGSATSAGNGGAGGNTTFGSLTANGGAGAANAAGGAGGTASGGYFNKAGASGGHG
SGLTSQWGGRGAASTFGDGGHEGQPNQAVGGTATANSGAGGGGAGCGATVNSGGGGGSGG
YLRAIINNPSASYSYAVGAAGTAGTAGSGGVAGGAGGSGVIMVTEHYGP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaactcttcgaccgagtgaaagtcaacactccgactaccgggaccggtgacgtt
actttcggctctgtgtcttcgaatgcgttcgtgacgccagccgaagccggagccggagac
ggcgatactgtccgctaccttatcgttgacggtaccgactttgaagttggaatcggtacg
attaaaagtggcgttaccgcaatggaacggacaacggtcaaagagtccaagattggcggt
accgcgggaacatcaaagattaacttgagcggtgtggccgctctgtcgctcactgcgtcg
gcggcggatatccttgtccctggtaataacctcgccgacttggacgacgcggacgaagcc
ctcgacaatctaggagcgaccacggtcggcaaggcgttgtttacggcggccgatgcggaa
aatgcgcgagcggcattggatctatctgacacgctccccacgactcaggttttcacttcc
ggagccggcacctacaccacgccagcgggctgcaagtggatcgaagtcgagatgattggc
ggcggcggcggcggtgctggttcggccacttcggcgggcaatggcggagcgggcggtaat
acgacttttggttcgctgacagccaatggcggtgcgggtgcggcaaacgccgctggcggt
gcgggcggcactgcttccggcggttacttcaacaaagccggggcatctggtggccatgga
tcaggacttaccagccaatggggcggtaggggtgccgcaagtacatttggagatggcggg
cacgaggggcagccaaatcaagctgtaggtggcaccgccacagccaattctggcgctggt
ggcggcggtgctggctgcggcgccacggtcaattctggcggcggcggcggtagcgggggt
tacctgcgcgccatcattaataatccgagcgcgtcctactcttatgctgtgggagcggca
gggacagccggaacggctgggtcaggtggtgttgccggcggcgcgggcggctctggcgtc
attatggtcactgagcattacgggccgtga

DBGET integrated database retrieval system