KEGG   Nitrobacter winogradskyi: Nwi_1816Help
Entry
Nwi_1816          CDS       T00276                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00010  Glycolysis / Gluconeogenesis
nwi00020  Citrate cycle (TCA cycle)
nwi00620  Pyruvate metabolism
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01130  Biosynthesis of antibiotics
nwi01200  Carbon metabolism
Module
nwi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwi_1816
   00020 Citrate cycle (TCA cycle)
    Nwi_1816
   00620 Pyruvate metabolism
    Nwi_1816
Enzymes [BR:nwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nwi_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABA05077
UniProt: Q3SRL4
Position
complement(1988830..1990188)
Genome map
AA seq 452 aa AA seqDB search
MPINILMPALSPTMEKGNLARWLKKEGDAVKSGDVIAEIETDKATMEVEAVDEGTIAKIL
VPEGTQDVPVNNVIAVLAGDGEDVKAAASGATAAPGNEAKPESRADAKAGSGEAAGSPEP
SSRAPASKPASSGSQAAQPANGHARIFSSPLARRLASEAGIDLARIEGSGPHGRIVARDV
EQAKSGKGLKAAAAPAPAGAPSIAPSMSDKQILSLFEDGSYELVPHDNMRRTIAQRLTAS
IQNVPHFYLTMDCDIGRLLSAREEINASAPKDKEKKPLYKLSVNDFVIKAMAVALQRVPN
ANVSWTEGGMLKHKHSDVGVAVAMPGGLITPIIRKAETKTLSAISSEMKDFAARARARKL
KPEEYQGGTTAVSNLGMYGIKDFTAVINPPHATILAVGASEERAVVRGGRIEAAQIMSVT
LSCDHRAVDGALGAELIGAFKTLIENPVMMMV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcctgatgcccgcgctgtcgccgacgatggagaagggcaacctcgcg
aggtggctcaagaaggagggcgacgcggtcaagtccggggacgtcatcgccgagatcgaa
accgacaaggcgaccatggaagtcgaagcggtggacgaaggcaccatcgcgaagatcctg
gtgccggaaggaacgcaggacgtgccggtcaacaacgtcatcgcggtgctcgccggtgac
ggcgaggacgtgaaggcggcggcgagcggagccacggcagcgcctgggaacgaagcaaaa
ccagaatccagggcggatgcgaaagctggcagcggcgaagcggctggttctccggaacca
tcctcccgcgcccctgcgtccaagcctgcatcatccggatcgcaagcggcgcagccggcg
aacggccacgctcgcatcttctcatcgccgctagcgcggcggctcgccagtgaagccggc
attgacttggcgcgtatcgagggtagcggtccgcatggccgcatcgtcgcgcgcgacgtg
gagcaggcgaagtccggcaagggcctgaaggcggcggctgcgcccgccccggcaggcgcg
ccgtcgatcgcgccatcgatgtcggacaagcagatcctgtcgctgttcgaggacggctcc
tacgaactcgtcccccatgacaacatgcgccgcacgatcgcgcagcgcctgaccgcgtcg
atccagaacgttccgcatttctatctgacgatggactgcgacatcgggcggctgctgtcc
gcgcgtgaagagatcaacgcgtccgcgccgaaggacaaggaaaagaagccgctctacaag
ctctcggtcaacgacttcgtcatcaaggcgatggcggtggcgctgcaacgcgtgccgaac
gccaatgtgagctggaccgaaggcggcatgctgaaacacaagcattccgatgtaggcgtc
gccgtcgcgatgccgggcggactgatcacgccgatcatccgcaaggccgaaacgaaaaca
ctctccgccatctcatccgagatgaaggattttgccgcgcgggcgcgggcccgcaaactc
aagcccgaggaatatcagggcggcaccacggccgtttccaacctcggcatgtacggcatc
aaggattttaccgcggtcatcaacccgccgcacgccacgatcctcgcggtcggcgccagc
gaggagcgggcggtcgtgcggggcggcaggatcgaggcggcgcagatcatgagcgtgacc
ttgagttgcgatcaccgcgcggtcgacggcgcgctcggcgcggagttgatcggcgcgttc
aagacgctgatcgagaatcccgtgatgatgatggtgtga

DBGET integrated database retrieval system